LOADING...
   ZP_02033568.1;SP18677A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02033568.1    SP18677A            JCSG 418198 PDB Deposition 15-MAY-23              PDB id: 5bmt

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02033568.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 412982; Fold and function assignment.
DR TVPC; ZP_02033568.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02033568.1; Ortholog view popup.
DR TPM; ZP_02033568.1; Target PDB monitor.
DR FSS; ZP_02033568.1; Target function coverage.
PROPERTY Residues: 261 aa
Molecule Weight: 28238.28 Dalton
Isoelectric Point: 4.98
Extinction Coefficient: 30830
Gravy Index: -.11
Number of Met residues: 8
Percentage of Met residues: 3.07 %
Number of Cys residues: 3
Percentage of Cys residues: 1.15 %
SEQUENCE  amino acids 261 aa
>ZP_02033568.1  gi|154494248|ref|ZP_02033568.1| hypothetical protein PARMER_03598 [Parabacteroides merdae ATCC 43184
MKKLKVLGLAAIAAGMFSLTSCLDGGGNTQQLSSYAIVDYSSTMRTLIYPLGYYPLYVAT
IANDPTYRAGDCVLANFTVDFDSADNANASTNGFYVATGAASSPLAKYDLSYSPLDSMAL
DNELLLSGSESALLFSNNYKRIVVIPTFTSVLTDQKNTYIMSMDSNQEPETVDGTDRVYT
LCLRAQKREEGKAPTISNAMDPIAVEGGTLYSMLKGKESAAGKKIVSYRVKYPLTFNADS
TKIATWGYSKISQFSIEEATN

CDS  cDNA 786 bp
   1 atgaagaaac ttaaagtttt agggttagca gcaatcgctg cgggtatgtt ttcgttaacc    60
  61 tcttgtttgg acggcggcgg taatacacag caactttcaa gttatgctat agtcgattat   120
 121 tcttctacga tgagaactct gatttatcca ttgggctatt atccgttgta tgtcgctaca   180
 181 attgcaaatg atccgactta tagggctgga gattgtgtgt tggctaattt tacggtcgat   240
 241 tttgattcgg cggataatgc gaatgccagt acaaatggtt tttatgtggc gacaggagct   300
 301 gcttcttctc cattagcaaa atatgatttg agttattctc cattggactc aatggcatta   360
 361 gataatgaat tgcttttgtc tggttccgaa agtgcattgt tattttctaa taattataag   420
 421 agaatcgttg ttattcctac ttttacatct gtgttgacgg atcagaagaa cacatatata   480
 481 atgtcgatgg attctaatca agaacctgaa actgttgatg gaacggaccg tgtttatacg   540
 541 ttgtgcttac gtgctcaaaa gcgggaagaa gggaaagcac caaccattag caatgctatg   600
 601 gacccgatcg ctgttgaagg aggtacatta tattctatgt tgaaaggaaa agaatcagca   660
 661 gcagggaaga agattgtaag ttatcgtgtg aagtatcctt tgacattcaa cgcagattcg   720
 721 acaaagatag cgacttgggg gtattctaaa atttctcaat tctcgattga ggaagctaca   780
 781 aattaa   786
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu