LOADING...
   ZP_02032758.1;SP13725A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032758.1    SP13725A            JCSG 420083 PDB Deposition 14-FEB-06              PDB id: 4opw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02032758.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4OPW; Identical; 02-APR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 3LJY; Highly similar; 02-MAR-10; PUTATIVE ADHESIN;
DR PDB; 3JX8; Highly similar; 10-NOV-09; PUTATIVE LIPOPROTEIN;
DR FFAS; 412919; Fold and function assignment.
DR TVPC; ZP_02032758.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02032758.1; Ortholog view popup.
DR TPM; ZP_02032758.1; Target PDB monitor.
DR FSS; ZP_02032758.1; Target function coverage.
PROPERTY Residues: 261 aa
Molecule Weight: 28292 Dalton
Isoelectric Point: 8.27
Extinction Coefficient: 11460
Gravy Index: -.23
Number of Met residues: 6
Percentage of Met residues: 2.30 %
Number of Cys residues: 3
Percentage of Cys residues: 1.15 %
SEQUENCE  amino acids 261 aa
>ZP_02032758.1  gi|154493438|ref|ZP_02032758.1| hypothetical protein PARMER_02777 [Parabacteroides merdae ATCC 43184
MKTKGLLMIAFLMGMFFSTQAADHVKGNGKLSTKKITIDDFNAIKFDGVIDFNYEQSEST
PHIEITVDENLHPYVNIDIQDRVLTVGFKGAKVDHFTKFIVKTNSKWLKEVKASGNANFI
ANSPLKGDELKINANSNCLVQLKQKVEVGKLDLNVSGSANMVVNELKTDKLECSINGSGT
INLKAGNAEEADYSITTDGEIMAFGVAVPEVNCKITGKGSAQIHPTDNLKATIVGKGNIR
YKGPTAVQQKVIGKGTVEEVK

CDS  cDNA 786 bp
   1 atgaaaacaa aaggtttact aatgatcgct ttcctaatgg gaatgttttt ctctacccag    60
  61 gcagcagatc atgtgaaagg aaacggaaag ctctcgacca agaaaataac gatcgacgac   120
 121 ttcaatgcca tcaagttcga cggggtgatc gacttcaact acgaacaatc ggaatctact   180
 181 ccgcatatcg aaataaccgt agatgaaaac ctgcacccat acgtaaacat cgatatccaa   240
 241 gaccgtgtcc tgaccgttgg attcaaaggt gccaaagtcg accatttcac caaattcatc   300
 301 gtcaagacta actccaaatg gctgaaagag gtaaaagcct ctggcaatgc taacttcata   360
 361 gccaacagcc cattgaaggg tgacgaattg aaaatcaacg ccaactctaa ctgcctcgtc   420
 421 cagctaaagc agaaagtcga agtcggcaag ctcgacctga acgtgtccgg tagcgccaat   480
 481 atggtcgtga atgaactcaa aaccgacaag ttggaatgca gcattaacgg ttccggcacg   540
 541 atcaacctaa aagctggaaa cgccgaagaa gcagactaca gcatcacgac cgacggtgaa   600
 601 atcatggctt tcggggtggc agtgcccgaa gtgaactgta aaatcacagg caaaggttcc   660
 661 gcccagatcc atccgaccga caacctaaaa gcaacaatcg taggtaaagg aaatatccgc   720
 721 tataaaggcc cgacagccgt acaacagaaa gtcatcggca aaggaactgt tgaagaagta   780
 781 aaataa   786
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu