LOADING...
   ZP_02032754.1;SP13461A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032754.1    SP13461A            JCSG 419154 PDB Deposition 13-JUN-17              PDB id: 4l8k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02032754.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03572; Peptidase_S41;
DR PDB; 4L8K; Identical; 03-JUL-13; PUTATIVE PEPTIDASE;
DR FFAS; 412787; Fold and function assignment.
DR TVPC; ZP_02032754.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02032754.1; Ortholog view popup.
DR TPM; ZP_02032754.1; Target PDB monitor.
DR FSS; ZP_02032754.1; Target function coverage.
PROPERTY Residues: 338 aa
Molecule Weight: 38768.73 Dalton
Isoelectric Point: 5.07
Extinction Coefficient: 65780
Gravy Index: -.33
Number of Met residues: 11
Percentage of Met residues: 3.25 %
Number of Cys residues: 5
Percentage of Cys residues: 1.48 %
SEQUENCE  amino acids 338 aa
>ZP_02032754.1  gi|154493434|ref|ZP_02032754.1| hypothetical protein PARMER_02772 [Parabacteroides merdae ATCC 43184
MKPFFFFLCFLFLFGCEKATKYNSSPRDNFEALWRIMDENYCFFAFKDVDWDDVYDRYNL
LVKDTMNQYELFDILGKMLAEVKDGHTNLISSFDMSRYWAWYEDYPANFYKEIQDNYLGT
DYKIAGGMKYKRLADDQIGYVYYGSFSSGVGENNLDYMFAHFKECKGLIFDVRDNGGGSM
LYSDRIASRFLEERILTGYTQYKKGNGHNDFTQPNPVYLSPSDRTRWLRPVIVLTNRHSY
SATNDFVNVMRLLPQVTVMGDRTGGGSGLPFSSELPNGWSVRFSACPVLDVNKQHTEFGI
DPDTAVAITGEDIMKGRDTIIEAAIGLLLAKGDSAISY

CDS  cDNA 1017 bp
   1 atgaagcctt tcttcttttt cctctgtttt ctctttctct tcggttgcga gaaagcgaca    60
  61 aaatataact cgtctccccg tgataatttc gaggcgcttt ggcgtatcat ggacgagaat   120
 121 tactgcttct ttgccttcaa ggatgtggac tgggacgatg tgtatgaccg ctataatctg   180
 181 cttgttaaag acacgatgaa ccagtacgaa ttgtttgata tcctcggaaa aatgcttgcc   240
 241 gaggtgaaag acggacatac caatctgatc tcttctttcg atatgtcccg ttattgggct   300
 301 tggtatgaag attatccggc taacttctat aaagaaatac aggacaatta tcttggtacg   360
 361 gactacaaga ttgccggggg aatgaagtat aagcgtctgg cggacgatca gattggatat   420
 421 gtctattacg gtagtttttc aagtggcgtg ggtgaaaaca acctcgatta tatgtttgcg   480
 481 catttcaagg aatgcaaagg attgatattc gatgtgcgcg acaatggggg cggttccatg   540
 541 ctctattccg accgcatcgc ctcgcgtttc cttgaggaaa ggattctgac gggttacacg   600
 601 caatataaga aaggaaacgg gcataacgat tttacccagc ccaatccggt ctatctttcc   660
 661 ccgtctgacc gcactcgttg gttgcgcccg gtcatcgtct tgactaaccg gcattcttac   720
 721 agcgctacga acgattttgt caatgtgatg cgtctccttc cgcaagtcac ggtcatgggt   780
 781 gaccgtacgg gaggtggcag cggcctgcct ttcagttcgg aattgccgaa tgggtggagt   840
 841 gtccgtttct cggcttgtcc ggtcctggat gtgaacaaac agcacacgga gttcggaatc   900
 901 gatcccgaca ccgcggtagc cattacgggc gaggatatca tgaaaggacg ggacacgatt   960
 961 atagaggcgg cgatagggtt gttgctggca aagggggatt cggccatctc atactaa  1017
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu