LOADING...
   ZP_02032405.1;SP13677A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02032405.1    SP13677A            JCSG 419184 PDB Deposition 12-MAR-14              PDB id: 4e5v

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02032405.1
DESCRIPTIONPutative trehalose, ThuA like proteins, trehalose utilisation
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4E5V; Identical; 04-APR-12; PUTATIVE THUA-LIKE PROTEIN;
DR FFAS; 412869; Fold and function assignment.
DR TVPC; ZP_02032405.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02032405.1; Ortholog view popup.
DR TPM; ZP_02032405.1; Target PDB monitor.
DR FSS; ZP_02032405.1; Target function coverage.
PROPERTY Residues: 304 aa
Molecule Weight: 34425.17 Dalton
Isoelectric Point: 7.75
Extinction Coefficient: 59360
Gravy Index: -.5
Number of Met residues: 5
Percentage of Met residues: 1.64 %
Number of Cys residues: 3
Percentage of Cys residues: 0.99 %
SEQUENCE  amino acids 304 aa
>ZP_02032405.1  gi|154492779|ref|ZP_02032405.1| hypothetical protein PARMER_02418 [Parabacteroides merdae ATCC 43184
MRHLHFGKLFFVVFSLLLAYTVSARKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDV
DFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADN
AFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDK
VHPVVKGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNA
RIFHTMLGHAGATTEDNIAMQCTGFQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKD
YKEN

CDS  cDNA 915 bp
   1 atgagacatt tacattttgg gaagctgttt tttgttgtct tttccctctt gttagcctat    60
  61 acggtttcgg cgcgtaaacc gattaaaaca ttactgatca caggacaaaa caaccataac   120
 121 tggcaggtga gccatgttgt gctgaaacaa atcctggaaa attccggtcg ttttgatgtg   180
 181 gactttgtca tctctcccga acagggcaag gatatgtccg gttttgtgct cgactttagc   240
 241 ccttaccagt tggtagtgct ggactataac ggagattcgt ggccggagga gacgaaccgc   300
 301 cgcttcctgg aatatgtgca gaacggcggt ggtgttgtca tttatcatgc agccgacaat   360
 361 gctttctcca aatggccgga gttcaatagg atctgtgctt tgggtggttg ggaaggacgt   420
 421 aatgagaatt ccggccctta tgtgtattgg aaggacggaa aactggtcaa ggacagttcg   480
 481 gcgggtccgg gtggttctca tggacgccag cacgaatatg tgctgaacgg gcgtgacaag   540
 541 gtgcatccgg ttgtgaaggg cctgccttta aaatggcgtc atgccaaaga tgaactttac   600
 601 gaccgtatgc ggggaccggg caatatccgg gatattttgt acacggccta ttcggataag   660
 661 gaaacaaacg gttccggtcg tgaagaaccg ctggtattta cggtcgatta cgggaatgct   720
 721 cgcatcttcc atacgatgct tggccatgcc ggtgctacta cggaagataa tatagcaatg   780
 781 caatgtacgg gcttccaggt gcttttgctt cgtggcgccg aatgggcggc aaccggaaaa   840
 841 gtaacccaga aagtcccgaa agatttcccg acggagacta cttgttctta tcggaaagat   900
 901 tataaggaga attga   915
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu