LOADING...
   ZP_02031795.1;SP13528A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02031795.1    SP13528A            JCSG 419702 PDB Deposition 14-AUG-27              PDB id: 4r7f

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02031795.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4R7F; Identical; 17-DEC-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 412863; Fold and function assignment.
DR TVPC; ZP_02031795.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02031795.1; Ortholog view popup.
DR TPM; ZP_02031795.1; Target PDB monitor.
DR FSS; ZP_02031795.1; Target function coverage.
PROPERTY Residues: 424 aa
Molecule Weight: 48814 Dalton
Isoelectric Point: 4.68
Extinction Coefficient: 59140
Gravy Index: -.47
Number of Met residues: 12
Percentage of Met residues: 2.83 %
Number of Cys residues: 5
Percentage of Cys residues: 1.18 %
SEQUENCE  amino acids 424 aa
>ZP_02031795.1  gi|154492169|ref|ZP_02031795.1| hypothetical protein PARMER_01801 [Parabacteroides merdae ATCC 43184
MKMRVYSLLFMMLFALSIGANAQVKFFTDVNSKQIKTLQVKVAGELISEPYIALGGEEQI
EINFDGLGSGYTRYAYNVVHCNADWTQSQLSPIEYMNGFQGTTIDDFANSIGTTTQYSNY
RLLLPNDDVQFKVSGNYAIQVYNEDTPDQIIFTACFSVVEPVVNISASVSGNTDIDTNQS
HQQVSFNINNKNFPITYPQTDLKIFVYQDNRRDNAVTDLQPMSILENQISYTYNRNLIFP
AGNEYRRMEFLSNKYNGMHVENISFHNPYYNVELMTDYRRDKGTYQYDQDQDGRFFIRCS
DCNDPDTEADYYIVHFTLACDPLPDGSVYLNGELFNNVLDEKSKMGYNFETKQYEKAVLL
KQGSYNYQYLFVPTGSSVGQTGPIEGNYYQTQNEYSIYVYYRPMGARYDRLIGVTTVRNE
MQVF

CDS  cDNA 1275 bp
   1 atgaaaatga gagtgtacag tttactattt atgatgcttt ttgccctttc catcggggca    60
  61 aacgcacagg taaagttctt caccgatgtc aatagcaagc agataaaaac gcttcaggtg   120
 121 aaagttgccg gagagttgat atccgaacct tacatagcgt tgggaggaga agagcaaatt   180
 181 gaaatcaatt tcgacggttt ggggagtgga tacacacgat atgcctataa cgtggtgcat   240
 241 tgcaacgccg actggacgca atcgcagttg agtccgatcg aatatatgaa tggtttccaa   300
 301 ggaacaacaa tcgacgattt tgccaattcc atcgggacta cgactcaata ttcgaactac   360
 361 cggctattgc ttccgaacga cgatgtccag tttaaagttt ccggcaatta tgccatccag   420
 421 gtctataacg aggatacgcc ggaccagatc atttttacag cctgtttctc tgtggtagaa   480
 481 ccggttgtca atatctcggc ttcggtgagc gggaacacgg acatcgacac caaccagagc   540
 541 catcagcagg taagtttcaa catcaacaac aaaaattttc cgatcactta tccgcaaacg   600
 601 gacctgaaga tattcgttta ccaggacaac cggcgcgata atgccgtaac ggacttgcaa   660
 661 cctatgagca ttctggaaaa ccaaatatct tacacgtata accgcaacct tattttccct   720
 721 gccgggaatg agtatcgtcg catggagttc ctaagcaaca aatataatgg aatgcacgtc   780
 781 gaaaatatct ccttccacaa tccttactat aatgtggaac ttatgaccga ttacaggcgg   840
 841 gataaaggca cttaccaata tgaccaggat caggacggcc gtttcttcat tcgttgcagc   900
 901 gactgtaacg atccggatac ggaagcggat tattatatcg tgcattttac acttgcatgc   960
 961 gatccgctgc ccgatgggag tgtatatctg aacggtgagc tatttaataa tgtattggat  1020
1021 gaaaagagca aaatgggcta taacttcgag acgaagcaat acgaaaaagc cgtacttctc  1080
1081 aaacagggaa gttacaatta ccagtatttg tttgtcccga ccggttcctc tgtcggtcag  1140
1141 acaggtccga tagaaggtaa ttactaccag acacaaaatg aatatagcat ctatgtttat  1200
1201 tatcgtccga tgggtgctcg ctatgatcgg ctaattggtg tcacgactgt caggaacgag  1260
1261 atgcaggtat tctaa  1275
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu