LOADING...
   ZP_02030865.1;SP8921A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030865.1    SP8921A            JCSG 420094 PDB Deposition 14-JAN-30              PDB id: 4oo3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02030865.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4OO3; Identical; 05-MAR-14; HYPOTHETICAL PROTEIN;
DR FFAS; 412909; Fold and function assignment.
DR TVPC; ZP_02030865.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02030865.1; Ortholog view popup.
DR TPM; ZP_02030865.1; Target PDB monitor.
DR FSS; ZP_02030865.1; Target function coverage.
PROPERTY Residues: 466 aa
Molecule Weight: 52332.13 Dalton
Isoelectric Point: 5.53
Extinction Coefficient: 71280
Gravy Index: -.36
Number of Met residues: 12
Percentage of Met residues: 2.58 %
Number of Cys residues: 3
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 466 aa
>ZP_02030865.1  gi|154490924|ref|ZP_02030865.1| hypothetical protein PARMER_00841 [Parabacteroides merdae ATCC 43184
MKNYLVFSMAALLVGASCNTKQEKAAEGFTGAPGEVKLITLDPGHFHAALVQKVSYPQVS
KDVYVYAPTGFDVDEHLKRIQGFNTRAENPTAWNEIVYTGDDYLEKMLAEKKGNVMIQAG
NNGKKTEYIKKTLEAGINVLSDKPMAINSQSFKLLEECFAIAKQKNIMLYDIMTERNEIT
TMLQRELSTIPAVYGEQLKGSPEEPAIVKESVHHLFKLVDNKPLTRPVWYLDVNQQGEGI
VDVTTHLVDLVQWEAFPDQIIDYRKDIELIDANRWTTSISPEEFKQVTGTDAYPDFLKKD
VENDTLKVYCNGDIVYKIKGVTAKVSVIWNYTFPKGGGDTHFSVMKGSKADLVIRQGKEQ
NYQPELFVEAVKGVDLAAYEKDLTASMEKVSAEYPGVALNKVGDGVWQVEIPAKYRVGHE
AHFGQVTEHFLDYLKEGKLPDWEVPNMLAKYYTTTSALDMAKAKTK

CDS  cDNA 1401 bp
   1 atgaaaaact atcttgtatt ttctatggcg gccttgttgg tcggagcttc ttgcaacaca    60
  61 aagcaggaga aggcggccga aggctttacc ggcgcaccgg gagaagtgaa gttgatcacg   120
 121 ctcgatcccg gacatttcca tgccgcatta gtgcagaaag tgtcttatcc gcaagtttct   180
 181 aaagatgttt atgtgtacgc acccaccggt ttcgacgtgg acgagcactt gaaacgtata   240
 241 cagggattca acacacgtgc ggagaatccg acggcttgga atgaaatcgt ttatacggga   300
 301 gatgattacc tggaaaaaat gttggccgag aagaagggga acgtgatgat ccaggcagga   360
 361 aacaacggca agaagaccga atatatcaag aagacgcttg aggcgggtat caatgtgctt   420
 421 tccgacaaac cgatggcgat caacagccag agctttaaat tgctggagga atgtttcgct   480
 481 atcgccaaac agaaaaacat catgctgtat gacatcatga ccgaacggaa tgagatcact   540
 541 acgatgttgc agcgcgagct ttctactatc ccggctgttt atggcgagca gttgaagggt   600
 601 tctcccgaag aaccggctat cgtgaaagag agtgtgcacc atctgtttaa gctggtcgac   660
 661 aacaagccgt tgacgcgtcc ggtatggtat ctggatgtaa accagcaggg cgaaggtatt   720
 721 gtggatgtga cgactcacct ggtcgacctg gtgcagtggg aagccttccc ggatcagatc   780
 781 atcgactata ggaaagatat cgaactgata gatgccaacc gctggactac ctctatcagc   840
 841 ccggaagagt tcaaacaggt gacagggacg gatgcttatc ccgatttctt gaagaaagat   900
 901 gtcgaaaacg atacattgaa agtctattgc aacggtgata tcgtttataa gatcaaaggt   960
 961 gtgacagcca aggtttcggt gatctggaat tataccttcc ccaaaggtgg cggtgatacc  1020
1021 cacttctccg tcatgaaggg tagcaaggcc gacctggtca tccgccaggg caaggaacag  1080
1081 aactatcagc ctgaactgtt tgtcgaagca gtgaaaggtg tggatctggc cgcttacgaa  1140
1141 aaggacctga ccgcttctat ggaaaaggtt tcagccgaat atcctggtgt ggcattgaat  1200
1201 aaggtgggcg atggcgtatg gcaagtcgaa atccccgcaa aataccgtgt aggccatgaa  1260
1261 gctcatttcg gccaagtgac ggaacatttc cttgactatc tgaaggaagg caaactgccg  1320
1321 gattgggaag tacctaatat gctggctaag tattacacga cgacctcggc gctggatatg  1380
1381 gcgaaagcga agacaaaata a  1401
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu