LOADING...
   ZP_02030716.1;SP16962B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030716.1    SP16962B            JCSG 419167 PDB Deposition 14-APR-30              PDB id: 4q9a

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02030716.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00657; Lipase_GDSL;
DR PDB; 4Q9A; Identical; 25-JUN-14; TAT PATHWAY SIGNAL SEQUENCE DOMAIN PROTEIN;
DR PDB; 4OAP; Highly similar; 14-JAN-15; ACETYL XYLAN ESTERASE;
DR PDB; 3W7V; Highly similar; 12-FEB-14; ACETYL XYLAN ESTERASE;
DR PDB; 4JHL; Highly similar; 12-FEB-14; ACETYL XYLAN ESTERASE;
DR PDB; 4JJ4; Highly similar; 12-MAR-14; ACETYL XYLAN ESTERASE;
DR PDB; 4JKO; Highly similar; 12-FEB-14; ACETYL XYLAN ESTERASE;
DR PDB; 4OAO; Highly similar; 14-JAN-15; ACETYL XYLAN ESTERASE;
DR PDB; 4JJ6; Highly similar; 12-MAR-14; ACETYL XYLAN ESTERASE;
DR FFAS; 412823; Fold and function assignment.
DR TVPC; ZP_02030716.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02030716.1; Ortholog view popup.
DR TPM; ZP_02030716.1; Target PDB monitor.
DR FSS; ZP_02030716.1; Target function coverage.
PROPERTY Residues: 256 aa
Molecule Weight: 29043.79 Dalton
Isoelectric Point: 8.69
Extinction Coefficient: 40910
Gravy Index: -.38
Number of Met residues: 7
Percentage of Met residues: 2.73 %
Number of Cys residues: 5
Percentage of Cys residues: 1.95 %
SEQUENCE  amino acids 256 aa
>ZP_02030716.1  gi|154490775|ref|ZP_02030716.1| hypothetical protein PARMER_00689 [Parabacteroides merdae ATCC 43184
MKNSRRDFLKKGALAGFSALMIPEIAKAAVKENTSVHAPKINLKKDCVILFQGDSITDCG
RDRNSNRCNTMEQFGSGYVLFTATQLLEGKAALQPKIYNRGISGNKVYQLRERWEIDCLA
FQPDVLSILIGVNDYWHTLTHGYKGTVETYENDLRALLKYTKEKLPNTQIVLCEPFTLRD
GAAIEDSKWYPMFDEFRKSARKLSEEFNTIFVPFQSGFDAAVKLAPARYWSNDGVHPDLP
GRQLMANMWMEATGLK

CDS  cDNA 771 bp
   1 atgaagaatt ccagaagaga cttccttaaa aagggagcgt tggcagggtt cagtgccctg    60
  61 atgatcccgg agatcgcaaa agccgctgtt aaagaaaata catccgtaca tgctccgaag   120
 121 attaatctga aaaaggattg tgtgatcctg ttccagggag attccatcac ggactgcggt   180
 181 cgcgacagga atagtaaccg ttgcaatacg atggaacaat tcggtagtgg ctatgtgctc   240
 241 tttaccgcta cgcagttgtt ggaggggaaa gcggctttgc agccgaagat ttacaatcgc   300
 301 ggcatcagcg gcaataaagt ctatcaactt cgtgaacgct gggagatcga ctgtcttgct   360
 361 ttccagccgg atgtcctgag catcctgatc ggtgtgaatg attattggca tacgttgacg   420
 421 catggttata aaggaacggt cgagacatac gaaaacgatc tgcgtgcttt gttgaaatat   480
 481 acgaaagaga aactcccgaa tacgcaaata gtcctttgcg aacccttcac tttgcgtgac   540
 541 ggggcggcta tagaagattc caaatggtat ccgatgttcg atgaattccg caagtctgcc   600
 601 cgtaaactgt cggaagaatt caataccata ttcgttccct tccaatcggg tttcgatgca   660
 661 gcggtgaagc tggctccggc acgttattgg tcgaatgacg gtgtgcatcc cgatttaccc   720
 721 ggtcgccagc tgatggcaaa catgtggatg gaagcgactg gattaaagta a   771
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu