LOADING...
   ZP_02030627.1;SP0437A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02030627.1    SP0437A            JCSG 418199 PDB Deposition 13-SEP-26              PDB id: 4mxn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_02030627.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides merdae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4MXN; Identical; 23-OCT-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 412983; Fold and function assignment.
DR TVPC; ZP_02030627.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_02030627.1; Ortholog view popup.
DR TPM; ZP_02030627.1; Target PDB monitor.
DR FSS; ZP_02030627.1; Target function coverage.
PROPERTY Residues: 250 aa
Molecule Weight: 26600.91 Dalton
Isoelectric Point: 5.5
Extinction Coefficient: 13410
Gravy Index: .06
Number of Met residues: 5
Percentage of Met residues: 2.00 %
Number of Cys residues: 7
Percentage of Cys residues: 2.80 %
SEQUENCE  amino acids 250 aa
>ZP_02030627.1  gi|154490366|ref|ZP_02030627.1| hypothetical protein PARMER_00599 [Parabacteroides merdae ATCC 43184
MNKNKLFASVIGLLVFVAGLSAKDYQVAMFGIKSDGVTLNTRSIQRAVDYISEQGGGRLI
FYVGRYLTGSIELKSNVTIRIEEGAVLVAVPSVYDFKGVGGCNAIIYADKQKNIGIGGKG
IIDGRSIAVRASVEEQLQKGHIEGNVSDYAPALICMEGCEDVKIEQVTLQDAANVAEIYK
DCHNVTVDKVVVNAGASDRKAISISGCDGVKMTDCYFNMAGNPLESAGTSRNLIFTNCIT
PDGKAVSSDQ

CDS  cDNA 753 bp
   1 atgaataaaa ataaattatt tgcaagtgtg ataggccttt tggtctttgt ggcgggactt    60
  61 tcagctaaag attaccaagt cgcgatgttt ggaatcaaat cggacggagt gacactcaat   120
 121 acccgttcta tccagcgagc tgtcgattat atcagtgaac agggaggcgg ccggcttatt   180
 181 ttttatgtgg gccgttatct gactggttca atcgaactta agtcgaatgt gacgatccgt   240
 241 atcgaagagg gagccgtctt ggttgcagtt ccctccgttt atgattttaa aggggttgga   300
 301 ggatgtaatg cgattattta cgcagacaag caaaagaata tcggtatcgg tggaaaaggc   360
 361 attatcgatg gccgtagcat cgctgtgcgg gcaagcgtgg aagagcaatt gcaaaaaggg   420
 421 catatcgaag gaaatgtatc cgattatgca ccagctttga tctgcatgga aggctgcgag   480
 481 gatgtgaaaa tcgaacaagt caccctgcag gatgcagcga acgtagccga aatatataag   540
 541 gactgccata atgtgacagt cgacaaagtc gttgtgaatg ccggtgcatc ggaccggaaa   600
 601 gcaatctcga tttccggctg tgacggagtg aagatgacag attgctactt taatatggcg   660
 661 gggaatccgt tggagagtgc tgggacatcc cgtaatctaa tatttacaaa ttgtataaca   720
 721 ccagacggca aagctgtctc aagcgatcaa taa   753
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu