LOADING...
   ZP_01961911.1;SP13905C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01961911.1    SP13905C            JCSG 418985 PDB Deposition 14-JUL-07              PDB id: 4qt9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01961911.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF10091; Glycoamylase;
DR PDB; 4QT9; Identical; 06-AUG-14; PUTATIVE GLUCOAMYLASE;
DR PDB; 3EU8; Highly similar; 21-OCT-08; PUTATIVE GLUCOAMYLASE;
DR PDB; 4GL3; Highly similar; 29-AUG-12; PUTATIVE GLUCOAMYLASE;
DR FFAS; 406753; Fold and function assignment.
DR TVPC; ZP_01961911.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01961911.1; Ortholog view popup.
DR TPM; ZP_01961911.1; Target PDB monitor.
DR FSS; ZP_01961911.1; Target function coverage.
PROPERTY Residues: 467 aa
Molecule Weight: 52923.07 Dalton
Isoelectric Point: 6.09
Extinction Coefficient: 120210
Gravy Index: -.39
Number of Met residues: 14
Percentage of Met residues: 3.00 %
Number of Cys residues: 5
Percentage of Cys residues: 1.07 %
SEQUENCE  amino acids 467 aa
>ZP_01961911.1  gi|153809243|ref|ZP_01961911.1| hypothetical protein BACCAC_03554 [Bacteroides caccae ATCC 43185]
MKNKHHRRITTGSLLPLMLLFLSTLTLTFQSCKGKSSSNLTAATDSLSDDALMDTVQRRT
FLYFWEGAEPNSGLAPERYHVDGVYPQNDANVVTSGGSGFGIMAILAGIDRGYVTREEGL
ARMERIVSFLEKADRFHGAYPHWWYGDTGKVKPFGQKDNGGDLVETAFLMQGLLAVHQYY
ANGNDKEKAIAQRIDRLWREVDWDWYRKGGQNVLYWHWSPTYGWEMDFPIHGYNECMIMY
ILAAASPTHGVPAAVYHDGWAQNGAIVSPHKVEGIELHLRYQGTEAGPLFWAQYSFLGLD
PVGLKDEYCPSYFHEMRNLTLVNRAYCIRNPKHYKGFGPDCWGLTASYSVDGYAAHSPNE
QDDKGVISPTAALSSIVYTPEYSLQVMRHLYNMGDKVFGPFGFYDAFSETDNWYPQRYLA
IDQGPIAVMIENYRTGLLWKLFMSHPDVQAGLTKLGFNTNKQDVRQQ

CDS  cDNA 1404 bp
   1 atgaaaaata aacatcatag aagaatcaca acaggaagcc tactccctct catgctactg    60
  61 tttctatcca cccttaccct gaccttccaa agttgtaagg gaaaaagcag cagcaacctc   120
 121 accgccgcca ccgactcact atcggatgac gccttaatgg ataccgttca gcgaaggact   180
 181 ttcctttatt tctgggaagg tgcagaaccc aacagcggtc ttgcccccga acgttatcac   240
 241 gtagacggcg tatatccgca gaatgacgcc aacgtggtca cctccggcgg cagcggcttc   300
 301 ggcatcatgg ctatccttgc cggtatagac cgcggctacg tcacccgcga agaaggattg   360
 361 gcacgtatgg aacgtatcgt ctccttcctc gaaaaggccg accgttttca cggagcttac   420
 421 ccgcactggt ggtatggtga taccggaaaa gtgaagccgt tcggtcagaa agacaacggc   480
 481 ggcgacctcg tagaaaccgc cttcctgatg cagggtcttc tagccgtgca ccaatactac   540
 541 gcaaacggta atgacaaaga aaaggccata gcccaacgta tcgaccgcct ctggcgggag   600
 601 gtagactggg actggtaccg caaaggcgga caaaacgttc tttattggca ttggagtcct   660
 661 acttacggct gggaaatgga tttccccata catggctaca acgaatgcat gattatgtat   720
 721 atccttgccg ccgcttcacc gacgcacgga gtacctgccg ctgtctatca tgacggttgg   780
 781 gcacagaacg gagcgattgt ttccccgcac aaggtggaag gtatagaatt gcatctccgc   840
 841 taccagggca cggaagccgg accgcttttc tgggcacaat attctttcct cggcctcgac   900
 901 cccgtcggac tgaaagacga atactgtccc agctacttcc acgaaatgcg taacctgacg   960
 961 ctagtcaacc gcgcctactg tatccgcaac cccaaacact ataaaggttt cgggccggac  1020
1021 tgctgggggc tgaccgccag ttactccgtc gacggatacg ccgcccactc gccgaacgag  1080
1081 caggacgaca aaggggtcat ctcccccacc gccgcacttt cgtctatcgt ctacaccccg  1140
1141 gaatattctc tgcaagtgat gcgccaccta tataatatgg gagacaaagt attcggtcct  1200
1201 ttcggattct acgacgcttt cagcgaaacg gacaactggt atccgcaacg ctatctggct  1260
1261 atcgaccaag gacctatcgc cgtcatgatc gagaattacc ggacaggcct gttatggaaa  1320
1321 ctctttatga gccaccccga tgtacaagcc ggattgacga aactcggttt taataccaac  1380
1381 aaacaggatg tgagacaaca ataa  1404
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu