LOADING...
   ZP_01960758.1;SP7919F
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01960758.1    SP7919F            JCSG 419026 PDB Deposition 15-MAR-11              PDB id: 4yod

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01960758.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4YOD; Identical; 25-MAR-15; THIOREDOXIN-LIKE PROTEIN;
DR FFAS; 406852; Fold and function assignment.
DR TVPC; ZP_01960758.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01960758.1; Ortholog view popup.
DR TPM; ZP_01960758.1; Target PDB monitor.
DR FSS; ZP_01960758.1; Target function coverage.
PROPERTY Residues: 312 aa
Molecule Weight: 36011.62 Dalton
Isoelectric Point: 5.87
Extinction Coefficient: 49850
Gravy Index: -.31
Number of Met residues: 5
Percentage of Met residues: 1.60 %
Number of Cys residues: 5
Percentage of Cys residues: 1.60 %
SEQUENCE  amino acids 312 aa
>ZP_01960758.1  gi|153808090|ref|ZP_01960758.1| hypothetical protein BACCAC_02376 [Bacteroides caccae ATCC 43185]
MKTNLNILPILCFLLLWSCKSGNASSQTKNEVSQDTIKTFTLPAIPQIMVAPEQRAEFLV
KHYWDNVNFADTNYIHHPEITEQAWVDYCDILNHVPLKTAQEAIRKTIDRTNVDKKVFAY
ITDLADKYLYDPNSPMRNEEFYIPVLEAMAASPVLEEIEKVRPKARLELAQKNRIGTKAI
NFTYTLASGAQGSLYQLNADYLLLFINNPGCHACTETIEGLKQAPIISQLIKEKKLIVLS
IYPDEELDDWRKHLNEFPKEWINGYDKKFTIKEKQLYDLKAIPTLYLLNKEKTVLLKDAT
TQAIEEYLMIHQ

CDS  cDNA 939 bp
   1 atgaaaacaa acttaaatat ccttcccatt ctctgcttcc tcctcctttg gtcctgcaaa    60
  61 agcgggaatg cttcaagcca gactaaaaac gaagtgtcac aggacactat caagactttc   120
 121 acgctgcccg ctatccctca aataatggta gcaccggaac aacgtgccga gttcttagta   180
 181 aagcactact gggataatgt gaacttcgcc gacaccaact acattcatca tccggaaata   240
 241 accgaacagg cgtgggtgga ttactgcgac attctgaatc atgtccccct caaaaccgca   300
 301 caggaagcta tacgcaaaac gatcgaccgc acaaacgtag acaagaaagt attcgcctac   360
 361 atcaccgatt tagcggataa atacttatat gaccccaact ctccgatgcg taacgaggaa   420
 421 ttttatattc ccgtattgga agcaatggca gcctctcccg tattggaaga gatagaaaaa   480
 481 gtacgcccca aggcacggtt ggaattagct caaaagaacc gcataggcac caaagctata   540
 541 aacttcacct atacccttgc ttccggcgct caaggctccc tctatcagct taatgccgat   600
 601 tatcttctgc tatttatcaa taatcccggt tgccacgctt gtacggagac aatcgaaggt   660
 661 ttaaagcaag cccctatcat cagccaactc ataaaggaga agaagctgat cgtcctttct   720
 721 atctaccccg atgaagagtt ggatgactgg cgcaaacatc tgaatgaatt tcccaaagaa   780
 781 tggattaacg gatatgataa gaaattcaca atcaaagaga aacaactgta tgacctgaaa   840
 841 gcgatcccta ctttatacct attaaataaa gagaaaaccg tattgttgaa agatgctacc   900
 901 acacaagcga ttgaagaata cctgatgata catcaataa   939
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu