LOADING...
   ZP_01960523.1;SP13419B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01960523.1    SP13419B            JCSG 417591 PDB Deposition 14-MAR-04              PDB id: 4pqx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01960523.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4PQX; Identical; 18-JUN-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4J8Q; Highly similar; 06-MAR-13; PUTATIVE UNCHARACTERIZED PROTEIN;
DR FFAS; 406987; Fold and function assignment.
DR TVPC; ZP_01960523.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01960523.1; Ortholog view popup.
DR TPM; ZP_01960523.1; Target PDB monitor.
DR FSS; ZP_01960523.1; Target function coverage.
PROPERTY Residues: 242 aa
Molecule Weight: 28276.19 Dalton
Isoelectric Point: 4.8
Extinction Coefficient: 28880
Gravy Index: -.73
Number of Met residues: 6
Percentage of Met residues: 2.48 %
Number of Cys residues: 1
Percentage of Cys residues: 0.41 %
SEQUENCE  amino acids 242 aa
>ZP_01960523.1  gi|153807855|ref|ZP_01960523.1| hypothetical protein BACCAC_02139 [Bacteroides caccae ATCC 43185]
MYMKKLKFITLTLAIIITLPMLQSCLDDNDHQSRSLVISTINQISEDSKEFYFTLDNGKT
MFPSNSQAWGGEKFENGQRAFVIFNELEQPVNGYDYNIQVRDITKVLTKEIVTMDDEENT
EEKIGDDKINATYMWISKDKKYLTIEFQYYSTHSEDKKHFLNLVINNKEADSAAENEDNT
DDEYINLEFRHNSERDSPDHLGEGYVSFKLDKIEEQIEGKKGLNIRVRTLYDGIKNYKVQ
FP

CDS  cDNA 729 bp
   1 atgtatatga agaaattaaa attcattacc ttaactttag ctatcataat caccttaccg    60
  61 atgctgcaat cgtgcctgga cgacaatgat catcaatcgc gttcattggt tatcagcact   120
 121 atcaaccaaa tcagtgagga tagcaaagaa ttttatttca ctttggataa tggaaagacg   180
 181 atgttcccga gtaattcgca ggcatgggga ggcgagaaat ttgaaaacgg acaacgtgcc   240
 241 tttgttatat tcaacgagct ggaacaaccc gtaaacggat atgactacaa tatccaagtg   300
 301 agagatatta cgaaagtgtt aacaaaagag atcgtcacca tggacgatga agaaaataca   360
 361 gaagaaaaga tcggggatga taaaataaac gctacttata tgtggattag taaagataag   420
 421 aagtatctga ctatcgaatt ccagtactat agtacccata gtgaagacaa gaagcatttc   480
 481 ctgaatctgg ttatcaacaa taaggaagct gattccgctg ccgaaaacga agataatacc   540
 541 gatgacgaat atatcaatct ggaattccgt cacaacagtg aaagagattc tcccgaccat   600
 601 ttaggcgagg gatatgtatc tttcaaactg gataagatag aagaacagat agagggaaag   660
 661 aagggactga atatccgtgt cagaacttta tatgacggaa taaagaatta taaagtacaa   720
 721 tttccctga   729
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu