LOADING...
   ZP_01960481.1;SP13115A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01960481.1    SP13115A            JCSG 417579 PDB Deposition 14-FEB-25              PDB id: 4poi

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01960481.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4POI; Identical; 12-MAR-14; PUTATIVE PERIPLASMIC PROTEIN;
DR PDB; 4DSD; Highly similar; 21-MAR-12; PUTATIVE PERIPLASMIC PROTEIN;
DR PDB; 4QOA; Highly similar; 16-JUL-14; PUTATIVE PERIPLASMIC PROTEIN;
DR PDB; 3ELG; Highly similar; 14-OCT-08; UNCHARACTERIZED PERIPLASMIC PROTEIN;
DR PDB; 3DB7; Highly similar; 28-OCT-08; PUTATIVE CALCIUM-REGULATED PERIPLASMIC PROTEIN;
DR PDB; 3DUE; Highly similar; 05-AUG-08; PUTATIVE PERIPLASMIC PROTEIN;
DR FFAS; 406957; Fold and function assignment.
DR TVPC; ZP_01960481.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01960481.1; Ortholog view popup.
DR TPM; ZP_01960481.1; Target PDB monitor.
DR FSS; ZP_01960481.1; Target function coverage.
PROPERTY Residues: 150 aa
Molecule Weight: 16945.73 Dalton
Isoelectric Point: 6.85
Extinction Coefficient: 15470
Gravy Index: -.19
Number of Met residues: 4
Percentage of Met residues: 2.67 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 150 aa
>ZP_01960481.1  gi|153807813|ref|ZP_01960481.1| hypothetical protein BACCAC_02096 [Bacteroides caccae ATCC 43185]
MIMKKILSLLVLAIVAVQFSWAADVITKDMNQLPLPARNFINRHFTKPEVSHIKIDKEML
EATKYEVLLTDGTEIEFDSKGNWEEVSARKGQVIPASIVPNFAVDYLKAHNFAAEGVTKV
ERDRKGYEVELSTGVSFKFDKKGKFVKADD

CDS  cDNA 453 bp
   1 atgattatga agaaaattct atctttactc gtgttggcta ttgttgccgt acagttttca    60
  61 tgggctgctg atgtgataac taaagacatg aatcagttac cgcttccggc acgcaatttt   120
 121 attaaccgtc attttactaa acccgaagtg tctcatatca agattgataa ggaaatgctg   180
 181 gaggctacca aatatgaggt gttactgaca gacggtacgg aaatagaatt cgacagcaag   240
 241 ggaaactggg aagaagtaag tgcccgaaaa ggacaggtga ttcctgcaag tattgttccg   300
 301 aactttgccg ttgattatct gaaagcacat aattttgctg ctgaaggagt gacgaaagtg   360
 361 gagcgtgacc gtaagggata tgaagttgaa ttgtccacag gcgtctcttt caagtttgac   420
 421 aagaaaggga agtttgttaa agcggacgat taa   453
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu