LOADING...
   ZP_01960449.1;SP16782A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01960449.1    SP16782A            JCSG 419284 PDB Deposition 14-MAY-29              PDB id: 4qhw, 4qhx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01960449.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4QHW; Identical; 23-JUL-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4QHX; Identical; 23-JUL-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 407094; Fold and function assignment.
DR TVPC; ZP_01960449.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01960449.1; Ortholog view popup.
DR TPM; ZP_01960449.1; Target PDB monitor.
DR FSS; ZP_01960449.1; Target function coverage.
PROPERTY Residues: 418 aa
Molecule Weight: 47531.23 Dalton
Isoelectric Point: 8.94
Extinction Coefficient: 92250
Gravy Index: -.6
Number of Met residues: 7
Percentage of Met residues: 1.67 %
Number of Cys residues: 3
Percentage of Cys residues: 0.72 %
SEQUENCE  amino acids 418 aa
>ZP_01960449.1  gi|153807781|ref|ZP_01960449.1| hypothetical protein BACCAC_02064 [Bacteroides caccae ATCC 43185]
MKNLLCLLALLLCTTVFAQPQQVVVGVSGNGYVTRQQDGARITQRGVTHWTNPKSIVSIY
FYLHQPTTADLSLYAKGHSEIKVSYGKKGFKVNLQSNDFTKVPVGSIDIRQAGYVRIDLQ
GVSKSGEGFGEIKQLIADNVTGKSNYVKDFSDYWGRRGPSVHLGYALPEGDTEWFYNEIT
VPKEGETMHSYYMAAGFGEGYFGMQYNSPTERRILFSVWSPFDTQNPKEIPDDQKIKLLR
QGKDVHIGEFGNEGSGGQSYLKYPWKAGNTYKFLMQIRPDGNGNTTYTAYFYATDEKEWK
LIASFLRPKTNTWYKRPHSFLENFSPEQGYLSREVFFGNQWARSKEGKWSRLTDATFTHD
ATASAQVRLDYQGGNTKDNRFYLKMGGFFNESVPMGTKFYCKPTGKEPEIDWEALKQL

CDS  cDNA 1257 bp
   1 atgaaaaatt tattatgttt acttgcatta ctactatgca ctaccgtatt tgcacaacct    60
  61 caacaagttg tcgtaggagt ttccggcaat ggctatgtaa cccggcaaca agatggtgcg   120
 121 cgaataacac aaagaggagt tacacattgg acaaatccta aaagtatcgt tagtatttac   180
 181 ttctatttgc atcaaccgac aacagccgat ctgtcactgt atgccaaagg acattccgaa   240
 241 atcaaagtca gttatggaaa gaagggcttc aaagtcaatc tacaatcgaa tgatttcact   300
 301 aaagttcctg ttggaagtat cgatatacga caggcagggt atgtccgtat cgacttacaa   360
 361 ggagtctcta aaagtggtga gggtttcgga gaaattaagc agttgatagc agacaatgtt   420
 421 acaggtaaaa gtaattatgt gaaagacttc tctgactatt ggggacgccg cggtccttcc   480
 481 gttcatttgg gatatgcgct acctgaaggt gatactgaat ggttctacaa tgaaatcaca   540
 541 gtgcccaaag aaggcgaaac aatgcatagc tactacatgg cggccggctt cggggaaggt   600
 601 tatttcggaa tgcaatacaa ctccccgaca gaacgccgta ttcttttctc ggtatggagt   660
 661 ccttttgata cacaaaaccc caaagagatt ccggatgacc aaaagattaa actgttacgc   720
 721 caaggcaaag atgtacacat cggagagttt ggcaacgaag gctcaggcgg acaaagttat   780
 781 ttgaagtatc cctggaaagc cggtaataca tataaatttc tgatgcaaat cagaccggac   840
 841 gggaatggaa atacgaccta cactgcctat ttctatgcaa cagatgagaa agaatggaaa   900
 901 ttaatagcca gtttcttacg ccccaaaacc aacacatggt ataaacgtcc tcacagcttc   960
 961 cttgagaatt tcagtccgga acaaggatat ttatcacgtg aagttttctt cggcaaccaa  1020
1021 tgggcacgta gcaaagaagg taaatggtcc cgactcactg acgctacctt tacacacgat  1080
1081 gcaacagcga gtgcccaagt ccgtctcgac tatcaaggtg gcaatactaa agacaatcgg  1140
1141 ttttatctga aaatgggagg cttctttaac gaatccgttc caatgggaac taagttctat  1200
1201 tgcaagccaa caggcaaaga accggaaatt gattgggaag cattgaagca attgtaa  1257
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu