LOADING...
   ZP_01960021.1;SP14074A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01960021.1    SP14074A            JCSG 419028 PDB Deposition 13-AUG-13              PDB id: 4m8r

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01960021.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4M8R; Identical; 09-OCT-13; HYPOTHETICAL PROTEIN;
DR FFAS; 406884; Fold and function assignment.
DR TVPC; ZP_01960021.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01960021.1; Ortholog view popup.
DR TPM; ZP_01960021.1; Target PDB monitor.
DR FSS; ZP_01960021.1; Target function coverage.
PROPERTY Residues: 444 aa
Molecule Weight: 50006.7 Dalton
Isoelectric Point: 4.96
Extinction Coefficient: 76780
Gravy Index: -.44
Number of Met residues: 11
Percentage of Met residues: 2.48 %
Number of Cys residues: 4
Percentage of Cys residues: 0.90 %
SEQUENCE  amino acids 444 aa
>ZP_01960021.1  gi|153807353|ref|ZP_01960021.1| hypothetical protein BACCAC_01631 [Bacteroides caccae ATCC 43185]
MTKNKLFAWAITLLCFSLTSCSDEKDGPSKKILVTNAGVTEANQTVKPGDIVHIYGDGFQ
EGDQVDFDFRWDLGEPLFPEGYLGPVGAEIVERHSNGMSIRMPYRKPESRVEIFLNRASE
RMSLGKVLLADGQTPKDFRLYGINETDKTIERAYAEETVTGKKTWDMSAHPDFRSVVNLQ
KTYGLCGLAEENGVQQPFFLDFCTGEWKALSFYDYNTLALVIGSGNDIAAIQQRGKGYSL
YNVSAGLEQSNYATKTRSNFPMPEPQFELPEGFTPEQFGDYPGVFMQGNEIILLSARKGN
GKWVPMLYNYRNGFYVLEGIEADAIIPFYFGMALPDSGSPSLLYQKKVGYMIYYSSGDNR
GSSFRLLEPDKESSKLQLQEPFAQLSDKKVVSITNRLDRIGTITVLFSDKEKGRTTSDFD
WNSKEWTDYTDLSDMPYNSVVWAN

CDS  cDNA 1335 bp
   1 atgacaaaga ataaactatt cgcttgggct ataacacttc tctgcttttc gttgacctct    60
  61 tgcagcgatg aaaaggacgg tccgtcaaaa aagatattgg tgactaatgc aggggtgacg   120
 121 gaagctaacc aaacggttaa accgggagat atcgttcata tttatggtga tggttttcag   180
 181 gaaggcgacc aggtggactt tgactttcgc tgggatcttg gagaaccttt gttcccggaa   240
 241 gggtatcttg gacctgtcgg tgcggagatt gtagagaggc attcgaatgg aatgagtatc   300
 301 cgaatgcctt atcgcaagcc ggaatcacgt gttgagatat tcctgaacag ggcaagtgag   360
 361 agaatgtcgt tgggaaaagt actacttgca gatggacaaa cgcctaaaga tttcagactg   420
 421 tatggaataa atgagaccga caagacaata gagcgggcgt atgctgaaga aaccgtcact   480
 481 ggtaaaaaaa cgtgggatat gagtgcacat ccggacttcc gttcggttgt caatcttcaa   540
 541 aagacttatg ggctgtgcgg gctggcagaa gaaaatggtg tgcagcaacc cttcttcctt   600
 601 gatttctgta caggcgagtg gaaagcttta agtttctacg attataatac actggcattg   660
 661 gttattggca gcggaaatga tattgcggcc attcaacaga gaggtaaagg atattcatta   720
 721 tataatgttt ccgcaggttt ggaacaaagt aattatgcaa ctaagacgcg gagtaatttt   780
 781 cctatgccgg aacctcaatt tgaacttccg gaaggattta ctcctgaaca attcggggat   840
 841 tatccgggtg tgtttatgca aggtaatgag attattttat tgtcggcaag gaaaggaaac   900
 901 gggaaatggg ttcccatgtt gtataattat agaaatggct tttatgtact tgaagggatt   960
 961 gaagcagatg ccattattcc gttttatttc ggaatggcac ttcccgatag cggtagtcct  1020
1021 tccttattat accaaaagaa ggtcggttac atgatttatt actcatcagg tgacaatcgt  1080
1081 ggcagcagtt tccgtcttct tgaaccagat aaggagagca gcaagttaca gttacaagaa  1140
1141 ccgtttgctc aattgtccga taagaaagtt gtttcaataa ctaacagact tgaccgtatc  1200
1201 ggtacaatca ccgtgctctt ttccgataaa gaaaaagggc gcaccacttc tgattttgat  1260
1261 tggaacagca aagagtggac agattacacc gatctttctg atatgccata taactcagta  1320
1321 gtatgggcta attga  1335
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu