LOADING...
   ZP_01959896.1;SP16639B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01959896.1    SP16639B            JCSG 419289 PDB Deposition 14-AUG-19              PDB id: 4r4k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01959896.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4R4K; Identical; 01-OCT-14; UNCHARACTERIZED PROTEIN;
DR PDB; 2ML5; Identical; 19-MAR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 2ML6; Highly similar; 12-MAR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 407102; Fold and function assignment.
DR TVPC; ZP_01959896.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01959896.1; Ortholog view popup.
DR TPM; ZP_01959896.1; Target PDB monitor.
DR FSS; ZP_01959896.1; Target function coverage.
PROPERTY Residues: 185 aa
Molecule Weight: 21086.83 Dalton
Isoelectric Point: 4.88
Extinction Coefficient: 26930
Gravy Index: -.38
Number of Met residues: 2
Percentage of Met residues: 1.08 %
Number of Cys residues: 4
Percentage of Cys residues: 2.16 %
SEQUENCE  amino acids 185 aa
>ZP_01959896.1  gi|153807228|ref|ZP_01959896.1| hypothetical protein BACCAC_01506 [Bacteroides caccae ATCC 43185]
MNVKRFVCCLLASVLLLGVSLISCGNSSRAKAKNEIAQSGEDFKSFLDKFTSSAAFQYTR
IKFPLKTPITLLADDGETEKTFPFTKEKWPLLDSETMKEERIEQEEGGIYVSKFTLNEPV
HKVFEAGYEESEIDLRVEFEQAADGKWYVVDCYTGWYGYDLPIGELKQTIQQVKEENAAF
KEIHP

CDS  cDNA 558 bp
   1 atgaacgtga aaaggtttgt atgttgtctg ttagccagtg tgttgctgtt gggagtgtct    60
  61 ttgatttctt gcggtaatag ttccagggct aaagcgaaga atgagatagc acagtccggc   120
 121 gaggatttta aatcattcct tgataagttt acgtccagtg cagcattcca atatacccgt   180
 181 atcaagtttc cattaaagac accgattact ttattggccg atgacggaga aactgagaaa   240
 241 acgtttccgt tcaccaaaga aaaatggccg ttgctggata gtgaaacgat gaaggaggaa   300
 301 cgcattgagc aggaagaagg tggtatttat gtttctaagt tcactctcaa tgagccggtt   360
 361 cataaagtgt tcgaagcagg ttatgaggaa tcagaaatcg acttgcgtgt cgaatttgaa   420
 421 caggctgccg atgggaaatg gtatgtagtg gactgttata caggctggta tggatatgat   480
 481 ttgccgatcg gggaattgaa gcagaccatt cagcaagtaa aagaggaaaa tgcagctttc   540
 541 aaagagatac atccttga   558
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu