LOADING...
   ZP_01959821.1;SP15690A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01959821.1    SP15690A            JCSG 419032 PDB Deposition 13-JUN-13              PDB id: 4l7a

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01959821.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4L7A; Identical; 03-JUL-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 406918; Fold and function assignment.
DR TVPC; ZP_01959821.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01959821.1; Ortholog view popup.
DR TPM; ZP_01959821.1; Target PDB monitor.
DR FSS; ZP_01959821.1; Target function coverage.
PROPERTY Residues: 297 aa
Molecule Weight: 34545.62 Dalton
Isoelectric Point: 5.16
Extinction Coefficient: 76320
Gravy Index: -.36
Number of Met residues: 9
Percentage of Met residues: 3.03 %
Number of Cys residues: 5
Percentage of Cys residues: 1.68 %
SEQUENCE  amino acids 297 aa
>ZP_01959821.1  gi|153807153|ref|ZP_01959821.1| hypothetical protein BACCAC_01431 [Bacteroides caccae ATCC 43185]
MLDNKELIMKNWYIYLLCILVSSNFFACQDDDLEDQSIFDASEKEKSEFDRWLLENYVNP
YNIDFKYRMEHIESDYTHNLVPTDFWLSVKLAKIVKHCWLEAYDEVGGLDFTRACAPKVI
HLIGSASWDKGTYTLGTAEGGLKVTLYMGNWLDLTNVDRMNEYYFKVMHHEFAHILHQKK
NYPVDYDKISAGNYTPTGWQNRKLAEVAPLGFVTPYAGSKPSEDIAEVTACFLTYPEAQW
ENVMTLAGEKGKPIIDQKLAMVKKYMKDSWQVDLDLLRKVIARRTNEISELDLDHIY

CDS  cDNA 894 bp
   1 atgttagata ataaagaatt gattatgaaa aattggtata tatatttgct ttgtattctg    60
  61 gtgagcagca acttcttcgc ctgccaggac gatgacttgg aagaccagag tatttttgat   120
 121 gcatcagaga aagaaaagag tgagtttgac cgctggttac tcgaaaacta cgtcaatccc   180
 181 tataacatcg actttaaata cagaatggaa catattgaat ccgattatac gcacaatctt   240
 241 gtacctacgg acttttggtt gagtgtgaaa ttggcgaaga tagtgaaaca ttgctggctg   300
 301 gaggcctatg atgaagtggg aggtcttgat tttacacgtg cttgtgctcc gaaagttatt   360
 361 catcttatag gttctgcttc gtgggataag gggacgtata cactgggaac tgccgaaggc   420
 421 ggactgaaag tgactttgta tatgggtaac tggctggatt tgacgaatgt tgaccgcatg   480
 481 aatgaatatt acttcaaggt gatgcatcat gagtttgccc acattctgca tcagaaaaaa   540
 541 aattatccgg tagattatga taagattagt gcaggtaatt atacacctac cggttggcag   600
 601 aaccgtaaat tggcagaggt cgctcctttg ggatttgtca caccgtatgc cggtagtaaa   660
 661 ccgagtgagg atattgctga agtgacagcc tgtttcctga cttatccgga agcacagtgg   720
 721 gaaaatgtta tgactctggc tggagaaaaa ggtaaaccga tcattgacca aaagctggca   780
 781 atggtgaaga agtatatgaa agattcctgg caagtggacc ttgatctgct tcgcaaagtg   840
 841 attgcacgtc gtactaatga gattagtgaa ctggatttgg atcatattta ttaa   894
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu