LOADING...
   ZP_01959484.1;SP16569C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_01959484.1    SP16569C            JCSG 419275 PDB Deposition 14-APR-22              PDB id: 4q6k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONZP_01959484.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides caccae
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4Q6K; Identical; 01-OCT-14; BNR/ASP-BOX REPEAT PROTEIN;
DR PDB; 4BBW; Highly similar; 14-AUG-13; SIALIDASE (NEURAMINIDASE);
DR PDB; 4FJ6; Highly similar; 25-JUL-12; GLYCOSIDE HYDROLASE FAMILY 33, CANDIDATE SIALIDAS CHAIN: A,;
DR PDB; 2SIL; Highly similar; 31-AUG-94; SIALIDASE;
DR PDB; 2SIM; Highly similar; 30-NOV-94; SIALIDASE;
DR PDB; 1DIL; Highly similar; 07-DEC-96; SIALIDASE;
DR PDB; 1DIM; Highly similar; 07-DEC-96; SIALIDASE;
DR PDB; 3SIL; Highly similar; 11-NOV-98; SIALIDASE;
DR FFAS; 407060; Fold and function assignment.
DR TVPC; ZP_01959484.1; Homologs in PDB, JCSG and SG center.
DR OVP; ZP_01959484.1; Ortholog view popup.
DR TPM; ZP_01959484.1; Target PDB monitor.
DR FSS; ZP_01959484.1; Target function coverage.
PROPERTY Residues: 560 aa
Molecule Weight: 61862.46 Dalton
Isoelectric Point: 8.62
Extinction Coefficient: 88350
Gravy Index: -.23
Number of Met residues: 18
Percentage of Met residues: 3.21 %
Number of Cys residues: 4
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 560 aa
>ZP_01959484.1  gi|153806816|ref|ZP_01959484.1| hypothetical protein BACCAC_01090 [Bacteroides caccae ATCC 43185]
MINLYLCAQTINNTMKRNLLLLLSILFLSVCGTLQAVTSDTVFVRETQIPILIERQDNVL
FMLRLNAKESRSLDEVVLNFGKDVNMADIQSVKLYYSGTEARQNYGKKFFTPVSYISSHT
PGKTLAANPSYSINKSQVNNPGRKVILNANQKLFPGINYFWISLQMKPGASLLDKVSAKI
VTVKVDNKEALMHTVSPENIAHRVGVGVRHAGDDGSAAFRIPGLATTNKGTLLGVYDVRY
NSSVDLQEHVDVGLSRSVDGGKTWEKMRLPLAFGETGGLPAAQNGVGDPSILVDTKTNTT
WVVAAWTHGMGNQRAWWSSYPGMDMNHTAQLVLSKSTDDGKTWSEPINITDQVKDPSWYF
LLQGPGRGITMQDGTLVFPIQFIDSTRVPNAGIMYSKDRGETWKIHNYARTNTTEAQVAE
VEPGVLMLNMRDNRGGSRAVATTKDLGKTWTEHPSSRKALQEPVCMASLISVKAADNTLN
KDILLFSNPNTVKGRHHITIKASLDGGITWLPEHQVMLDEGDGWGYSCLTMIDKETVGIL
YESSVAHMTFQAIRLRDIIQ

CDS  cDNA 1683 bp
   1 atgataaatt tatatctttg tgcccaaaca attaataata ccatgaaaag aaacctactt    60
  61 ttattattat ctatcctttt tttatctgtc tgtgggactt tgcaggctgt tacatcggat   120
 121 actgtatttg tgcgtgaaac tcagattcca attttgattg aacgacagga taacgtgttg   180
 181 tttatgttgc gtttgaatgc aaaagagagt cgtagtttgg atgaagtagt tttgaatttt   240
 241 ggcaaagatg tgaatatggc ggatatacag tccgttaagt tatattatag tggtacggag   300
 301 gccagacaaa actatggtaa gaaattcttt actcccgtat cttatatttc cagccatacg   360
 361 ccggggaaga cattggctgc gaatccttct tattcaatta ataaatcaca ggtaaataat   420
 421 cccgggcgga aagtgatact gaatgctaat cagaaacttt ttcccggaat caattatttc   480
 481 tggatcagtc tgcaaatgaa accgggcgcc tctttgctgg ataaagtgtc agctaagatt   540
 541 gttactgtta aggttgataa taaagaagca cttatgcata cggtttcgcc ggagaatata   600
 601 gctcataggg taggagtagg ggtacgccat gccggtgacg atggttcggc tgccttccgt   660
 661 attccgggat tggcaactac taataaagga acattgctgg gagtttatga tgtacgttat   720
 721 aatagcagtg ttgatttgca ggaacatgtg gacgtcggtt tgagccgtag tgtagacggt   780
 781 ggtaaaacat gggagaagat gcgtttacct ttagcttttg gtgaaactgg cggtttgcct   840
 841 gctgcgcaga acggtgttgg cgacccttcg atcttagtgg ataccaagac caacacaaca   900
 901 tgggtggtgg cggcttggac acatggaatg ggtaatcagc gtgcttggtg gagttcttat   960
 961 ccgggaatgg atatgaatca tacggcccag ttggtattgt caaagagtac ggacgatggt  1020
1021 aaaacgtggt cggagcctat taatataaca gatcaggtga aagatccatc ctggtatttc  1080
1081 cttttgcaag gaccgggacg aggtatcacc atgcaagacg gcacattggt attcccgatt  1140
1141 cagtttatcg attctacccg tgttccgaat gcgggaatta tgtatagcaa agaccgtggc  1200
1201 gaaacatgga aaatccataa ctatgcacgc accaatacaa cagaagctca ggtagcggaa  1260
1261 gtggagcctg gcgtactgat gttaaatatg agagataacc gtggaggcag tcgtgctgtc  1320
1321 gctactacca aggatctcgg taagacttgg acagaacatc cttcttcccg taaagcttta  1380
1381 caggaaccgg tgtgtatggc aagtttaatc agcgtgaaag cggcagacaa cacattaaat  1440
1441 aaggatattc ttttattctc caatccgaat acggtaaaag gtcgtcatca tatcacgatc  1500
1501 aaggccagtc tggatggagg tatcacctgg ctacccgaac atcaagtgat gctggatgaa  1560
1561 ggtgacggtt ggggatattc ttgtttgaca atgattgata aagagacagt cggcatatta  1620
1621 tatgaaagca gtgtcgctca tatgactttt caggcaatcc ggctgagaga tataatacaa  1680
1681 tag  1683
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu