LOADING...
   YP_916642.1;YP_916642.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_916642.1    C.GT6391A            JCSG 424052 PDB Deposition 13-SEP-20              PDB id: 2ll0, 2mdz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_916642.1
DESCRIPTIONNMR structure of the putative ATPase regulatory protein, DUF1476 family protein, PF07345
ORGANISMParacoccus denitrificans pd1222
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07345; DUF1476;
DR PDB; 2LL0; Identical; 28-DEC-11; UNCHARACTERIZED PROTEIN;
DR PDB; 2MDZ; Identical; 09-OCT-13; UNCHARACTERIZED PROTEIN;
DR PDB; 5DN6; Identical; 28-OCT-15; CHAIN A;
DR PDB; 2KZC; Highly similar; 14-JUL-10; UNCHARACTERIZED PROTEIN;
DR FFAS; 424052; Fold and function assignment.
DR TVPC; YP_916642.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_916642.1; Ortholog view popup.
DR TPM; YP_916642.1; Target PDB monitor.
DR FSS; YP_916642.1; Target function coverage.
PROPERTY Residues: 104 aa
Molecule Weight: 11668.28 Dalton
Isoelectric Point: 4.76
Extinction Coefficient: 6990
Gravy Index: -.62
Number of Met residues: 2
Percentage of Met residues: 1.92 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 104 aa
>YP_916642.1  gi|119385587|ref|YP_916642.1| hypothetical protein Pden_2862 [Paracoccus denitrificans PD1222]
MTTFDDRERAHEAKFAHDAELNFKAEARRNRLLGEWAAGLLGKTGDDARAYALTVVTSDF
DEPGDEDVFRKLAADLEGKADEETIRAKMVELRATAREQIISEI

CDS  cDNA 315 bp
   1 atgaccacat ttgacgaccg cgagcgcgcg catgaggcga aattcgccca tgatgcggaa    60
  61 ctgaacttca aggccgaggc gcggcgcaat cgcctgctgg gcgaatgggc ggccggcctg   120
 121 ctgggcaaga cgggcgacga tgcccgcgcc tatgcgctga ccgtggtcac ctcggatttc   180
 181 gacgagccgg gcgacgagga cgtgttccgc aagctggcgg ccgacctgga aggcaaggcc   240
 241 gacgaggaaa ccatccgcgc caagatggtc gagctgcgcg ccaccgcgcg cgaacagatc   300
 301 atcagcgaga tctga   315
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu