LOADING...
   YP_877239.1;SP18005A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_877239.1    SP18005A            JCSG 418140 PDB Deposition 13-JUN-03              PDB id: 4l1n

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_877239.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium novyi nt
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4L1N; Identical; 26-JUN-13; CONSERVED LIPOPROTEIN, PUTATIVE;
DR FFAS; 410236; Fold and function assignment.
DR TVPC; YP_877239.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_877239.1; Ortholog view popup.
DR TPM; YP_877239.1; Target PDB monitor.
DR FSS; YP_877239.1; Target function coverage.
PROPERTY Residues: 240 aa
Molecule Weight: 27429.04 Dalton
Isoelectric Point: 9.13
Extinction Coefficient: 26930
Gravy Index: -.88
Number of Met residues: 6
Percentage of Met residues: 2.50 %
Number of Cys residues: 4
Percentage of Cys residues: 1.67 %
SEQUENCE  amino acids 240 aa
>YP_877239.1  gi|118443107|ref|YP_877239.1| conserved lipoprotein, putative [Clostridium novyi NT]
MKLNRLKLRRKVIYCLCASMTISSIMFMGCSKKGEEVNKKDVKIETNTNKKDSEKENVNN
TQENVSVEKQSAKKAKVKEDNSKKMFLKKELGKNSKPTFATKWKNSSNNKFSACIEGKGE
NALEEGVGKIYIKNLKEQSKWELDLDQDQQKNTPKYIDWFDDNNLMVVISRAHGTVSQGG
ILYKVNIETGQATELYNTKDNKKQVVYAVKKGDKIDVQILVYEDDDLLESHEETKTITVK

CDS  cDNA 723 bp
   1 atgaaattaa acagattaaa attaagaaga aaggtaatat attgtttatg tgctagtatg    60
  61 acaatctctt caataatgtt tatgggatgt tcaaaaaaag gcgaagaagt aaacaaaaag   120
 121 gacgttaaga tagaaacaaa tacaaataaa aaagattcag aaaaagaaaa tgtaaataat   180
 181 acacaagaaa atgtaagtgt agaaaagcaa tctgcaaaaa aagcaaaggt aaaagaagat   240
 241 aatagcaaaa agatgttttt aaaaaaagaa ctaggaaaaa attcaaaacc tacttttgca   300
 301 acaaagtgga aaaactctag taataacaaa tttagtgctt gtatagaagg aaagggagaa   360
 361 aatgcactag aagaaggagt aggaaaaata tatattaaaa atttaaaaga acaatcaaaa   420
 421 tgggaattag atcttgatca agatcagcaa aagaatactc ctaaatatat tgactggttt   480
 481 gatgataata atttaatggt tgtaataagt agagctcacg gaacagtttc acaaggggga   540
 541 atattgtata aagttaacat agaaacagga caagctactg aactttataa tactaaagac   600
 601 aataaaaagc aggttgtata tgcagttaaa aaaggtgata agatagatgt tcagatatta   660
 661 gtatatgaag atgatgattt attagaatca catgaagaaa caaaaactat aaccgtgaaa   720
 721 taa   723
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu