|
YP_807469.1;PE00025C |
Protein Sequence Comparative Analysis (PSCA) | |
|
YP_807469.1 PE00025C JCSG 368040 PDB Deposition 06-SEP-01 PDB id: 2i8d Protein Sequence Information
SEQUENCE amino acids 122 aa >YP_807469.1 gi|116495735|ref|YP_807469.1| hypothetical protein LSEI_2283 [Lactobacillus casei ATCC 334] MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKK HLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFW QR CDS cDNA 369 bp 1 atgggctcac ttgctgaatg gtaccaacgc attcccacgc ctgatgattt aacccgagtc 60 61 gaatcacttt ttgctaacat gcaggcacaa ttcccgcaac tcaagctcga attcaagtgg 120 121 aatcagccca tgttcactga ccatggtacg tttattatgg gctttaatcc gtccaaaaag 180 181 caccttgctg tagccatcga gccacaaacc atgacgcgtt tcatcccgca aatcgacaaa 240 241 gccggttacg accatagcca aatcattcgc ttcccatggc acaagccact agacgagcag 300 301 ttgatccacg acctcatcgc ctacacgatt gaccaaaaga aagatgcgac tactttctgg 360 361 cagcgatag 369Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |