LOADING...
   YP_807469.1;PE00025C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_807469.1    PE00025C            JCSG 368040 PDB Deposition 06-SEP-01              PDB id: 2i8d

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_807469.1
DESCRIPTIONProtein of unknown function from DUF1801 with fold belonging to the YdhG-like SCOP family
ORGANISMLactobacillus casei atcc 334
COMMENT 
DR UNIPROT; Q035U5_LACC3
DR SPTR;
DR GenBank; YP_807469
DR Pfam; PF08818; DUF1801;
DR PDB; 2I8D; Identical; 19-SEP-06; UNCHARACTERIZED CONSERVED PROTEIN OF COG5646;
DR PDB; 2OC6; Highly similar; 16-JAN-07; YDHG PROTEIN;
DR PDB; 2KL4; Highly similar; 14-JUL-09; BH2032 PROTEIN;
DR FFAS; 368040; Fold and function assignment.
DR TVPC; YP_807469.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_807469.1; Ortholog view popup.
DR TPM; YP_807469.1; Target PDB monitor.
DR FSS; YP_807469.1; Target function coverage.
PROPERTY Residues: 122 aa
Molecule Weight: 14434.85 Dalton
Isoelectric Point: 6.5
Extinction Coefficient: 26470
Gravy Index: -.52
Number of Met residues: 5
Percentage of Met residues: 4.10 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 122 aa
>YP_807469.1  gi|116495735|ref|YP_807469.1| hypothetical protein LSEI_2283 [Lactobacillus casei ATCC 334]
MGSLAEWYQRIPTPDDLTRVESLFANMQAQFPQLKLEFKWNQPMFTDHGTFIMGFNPSKK
HLAVAIEPQTMTRFIPQIDKAGYDHSQIIRFPWHKPLDEQLIHDLIAYTIDQKKDATTFW
QR

CDS  cDNA 369 bp
   1 atgggctcac ttgctgaatg gtaccaacgc attcccacgc ctgatgattt aacccgagtc    60
  61 gaatcacttt ttgctaacat gcaggcacaa ttcccgcaac tcaagctcga attcaagtgg   120
 121 aatcagccca tgttcactga ccatggtacg tttattatgg gctttaatcc gtccaaaaag   180
 181 caccttgctg tagccatcga gccacaaacc atgacgcgtt tcatcccgca aatcgacaaa   240
 241 gccggttacg accatagcca aatcattcgc ttcccatggc acaagccact agacgagcag   300
 301 ttgatccacg acctcatcgc ctacacgatt gaccaaaaga aagatgcgac tactttctgg   360
 361 cagcgatag   369
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2284003 2284371 1 Glimmer3 score 7.3 poor
Genemark probabilities .62   .82 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu