LOADING...
   YP_614837.1;EK8604E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_614837.1    EK8604E            JCSG 387075 PDB Deposition 08-APR-10              PDB id: 3csv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_614837.1
DESCRIPTIONPutative aminoglycoside phosphotransferase (protein kinase-like fold)
ORGANISMSilicibacter sp. tm1040
COMMENTYP_614837.1 from Silicibacter sp. TM1040 encodes a putative aminoglycoside phosphotransferase. It belongs to the SCOP fold Protein-kinase like, which also contains two other aminoglycoside phosphotransferase families.

The biological unit of YP_614837.1 is a dimer. Each monomer contributes two residues (Glu81 and His83) to a Zn binding site, which is located on the surface of the dimer interface.

Aminoglycoside phosphotransferases are a major contributor to antibiotic resistance of drugs that target the 16-S ribosomal subunit. These enzymes are highly promiscuous and can inactivate multiple drugs (ref 1 and 2). Although superposition of YP_614837.1 against known aminoglycoside phosphotransferases shows that the structural core is conserved, the location of the metal binding site and active site location do not appear to be conserved.

YP_614837.1 is also structurally similar to 2ppq, which is annotated as a homoserine kinase.
DR UNIPROT; Q1GCP1_SILST
DR SPTR; Q1GCP1 (flat text); Q1GCP1 (good view)
DR GenBank; YP_614837
DR Pfam; PF01636; APH;
DR PDB; 3CSV; Identical; 22-APR-08; AMINOGLYCOSIDE PHOSPHOTRANSFERASE;
DR FFAS; 387075; Fold and function assignment.
DR TVPC; YP_614837.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_614837.1; Ortholog view popup.
DR TPM; YP_614837.1; Target PDB monitor.
DR FSS; YP_614837.1; Target function coverage.
PROPERTY Residues: 332 aa
Molecule Weight: 37759.5 Dalton
Isoelectric Point: 5.26
Extinction Coefficient: 38390
Gravy Index: -.33
Number of Met residues: 7
Percentage of Met residues: 2.11 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 332 aa
>YP_614837.1  gi|99082683|ref|YP_614837.1| aminoglycoside phosphotransferase [Silicibacter sp. TM1040]
MTSREDEIRDFLATHGYADWNRTPLAGDASSRRYQRLRSPTGAKAVLMDWSPEEGGDTQP
FVDLAQYLRNLDISAPEIYAEEHARGLLLIEDLGDALFTEVINNDPAQEMPLYRAAVDLL
IHLHDAQTPELARLDPETLSEMTRLAFSEYRYAILGDAAEDNRKRFEHRFAQILSAQLEG
DMVFVHRDFHAQNLLWLPEREGLARVGVIDFQDAKLGHRAYDLVSLLQDARRDVPAQVEA
QMIDHYIQATGVDESHFRSAYAVIAVQRNMRILGIFARLSQRFGKRHYIEFVPRVWAHFE
RGLAHPALASAAEEILNALPAPAPEVLERLRA

CDS  cDNA 999 bp
   1 atgacatctc gcgaggacga aatcagagat tttctggcca cccatggcta tgcggactgg    60
  61 aaccgcaccc cactggccgg agatgcctcc agccgtcgct accagcggct gcgctctcca   120
 121 actggggcca aggcggtctt gatggactgg tccccagagg aaggcggcga cacgcaaccg   180
 181 tttgtggatc tcgcccaata cctgcgcaat ctcgatatct ccgctccaga gatttatgcc   240
 241 gaggaacacg cgaggggctt gctgttgatt gaggacctgg gcgacgcctt gtttacggag   300
 301 gtcattaaca acgacccggc gcaggaaatg ccgctctatc gcgctgctgt agatctgctg   360
 361 atacatctgc acgacgcgca aactccggag ctggcgcgac ttgacccaga gaccctgagc   420
 421 gagatgaccc gccttgcttt cagcgagtat cgctatgcaa tcctcggaga tgcggcagaa   480
 481 gacaatcgga agcgatttga acaccggttt gcgcaaatcc tgagcgcgca acttgagggc   540
 541 gacatggtct ttgtccaccg cgactttcac gcccaaaacc tgctgtggtt gccggagcgc   600
 601 gaaggcctcg ctcgcgtcgg agtgatcgat ttccaggatg ccaaactcgg ccaccgtgcc   660
 661 tatgatctcg tctcactttt gcaggatgcg cgccgcgatg ttcctgccca agtcgaagca   720
 721 cagatgatag accactatat tcaagccaca ggcgtcgatg agagccattt tcgcagcgcc   780
 781 tacgcggtca tcgcagtgca gaggaacatg cgcattctcg ggatttttgc gcggctatcg   840
 841 caacgctttg gcaagcgtca ctacatcgag ttcgtgcccc gggtctgggc gcattttgaa   900
 901 cgcgggttgg cccaccctgc ccttgcgagc gcggcagaag agatcctgaa tgccctgccc   960
 961 gcaccggcgc ccgaggtcct agaaaggctc cgcgcatga   999
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3011056 3012054 1 Glimmer3 score 6.85 poor
Genemark probabilities .84   .65 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu