LOADING...
   YP_614688.1;HP10622L
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_614688.1    HP10622L            JCSG 375176 PDB Deposition 10-JUN-01              PDB id: 3na6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_614688.1
DESCRIPTIONsuccinylglutamate desuccinalase
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GD40_SILST
DR SPTR; Q1GD40 (flat text); Q1GD40 (good view)
DR GenBank; YP_614688
DR Pfam; PF04952; AstE_AspA;
DR PDB; 3NA6; Identical; 28-JUL-10; SUCCINYLGLUTAMATE DESUCCINYLASE/ASPARTOACYLASE;
DR PDB; 3CDX; Highly similar; 11-MAR-08; SUCCINYLGLUTAMATEDESUCCINYLASE/ASPARTOACYLASE;
DR PDB; 2QJ8; Highly similar; 24-JUL-07; MLR6093 PROTEIN;
DR KEGG; 3.5.1.-; Enzyme page
DR FFAS; 375176; Fold and function assignment.
DR TVPC; YP_614688.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_614688.1; Ortholog view popup.
DR TPM; YP_614688.1; Target PDB monitor.
DR FSS; YP_614688.1; Target function coverage.
PROPERTY Residues: 330 aa
Molecule Weight: 35653.48 Dalton
Isoelectric Point: 4.8
Extinction Coefficient: 24410
Gravy Index: -.08
Number of Met residues: 11
Percentage of Met residues: 3.33 %
Number of Cys residues: 3
Percentage of Cys residues: 0.91 %
SEQUENCE  amino acids 330 aa
>YP_614688.1  gi|99082534|ref|YP_614688.1| Succinylglutamate desuccinylase/aspartoacylase [Silicibacter sp. TM1040
MKDNPISPTIPLDQDGVHHGFLKLPYSRDDSAWGSVMIPITVIQNGAGKTALLTGANHGD
EYEGPVALQELAATTRAEDVTGRLIIVPYFNYPAFRASARTSPIDRGNLNRAFPGRPDGT
VTQKIADYFQRTLLPMADVAVDFHSGGKTLDFVPFAAAHILEDKVLQDACFAAMQAFNAP
YSVQLLEIDSEGMYDTAVEEMGKVLVTTELGGGGMSTARSNAIAKKGLRNVLIHFGILQG
EMQIDPSVTLDMPDGDCYLFSEHDGLFEIMIDLGEPVQEGDLVARVWSPDRTGEAPVEYR
ARRSGVLISRHFPGMIKSGDCAAVIGVVEG

CDS  cDNA 993 bp
   1 atgaaagaca atccgatttc cccgacgatt ccgctcgatc aggatggtgt ccaccacgga    60
  61 tttctgaaac tgccttacag ccgtgacgac agcgcctggg gctctgtgat gatcccgatc   120
 121 accgtcattc agaacggcgc cggcaagact gcgctgttga cgggtgccaa tcacggcgat   180
 181 gaatacgaag gccccgtggc gttgcaggaa ctcgccgcca ccacccgtgc cgaggatgtg   240
 241 accggcaggc tcattattgt gccttacttc aactaccctg cctttcgcgc cagtgcgcgg   300
 301 acctcgccca tcgaccgggg caatctcaac cgcgcctttc cgggccgtcc cgatggcacc   360
 361 gtcacgcaaa agatcgcgga ttactttcag cgtacgctcc tgccgatggc ggatgtggcg   420
 421 gtggatttcc actccggcgg caagacgctg gattttgtcc cctttgccgc tgcgcatatc   480
 481 ctcgaggaca aggtgctgca ggatgcgtgc tttgccgcca tgcaggcctt caacgcgccc   540
 541 tactcggtgc aactcctcga gatcgacagc gagggcatgt atgacaccgc cgtcgaggaa   600
 601 atgggcaagg tgctcgtgac caccgaactt ggcggcggtg gcatgtccac cgcgcgcagc   660
 661 aatgccatcg ccaagaaagg tctgcgcaac gtgctgattc actttgggat cttgcagggc   720
 721 gagatgcaga ttgacccgag tgtgacgctc gatatgcccg acggggattg ctacctcttc   780
 781 agcgagcacg acgggttgtt tgagatcatg atcgatcttg gcgaacctgt gcaagagggc   840
 841 gatctggtcg cccgcgtctg gtcgcccgac cgcaccggag aggccccggt ggaataccgc   900
 901 gcccgccgca gcggcgtgct catcagccgc catttccccg gtatgatcaa atccggtgac   960
 961 tgcgccgcgg tgatcggcgt ggtcgagggc tga   993
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2835568 2836560 -1 Glimmer3 score 14.71 good
Genemark probabilities .92   .91 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu