LOADING...
   YP_614486.1;FK9370B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_614486.1    FK9370B            JCSG 371276 PDB Deposition 07-MAR-28              PDB id: 2pbl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_614486.1
DESCRIPTIONPutative thioesterase [Alpha/beta-Hydrolases]
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GDP2_SILST
DR SPTR;
DR GenBank; YP_614486
DR PDB; 2PBL; Identical; 17-APR-07; PUTATIVE ESTERASE/LIPASE/THIOESTERASE;
DR PDB; 4E11; Highly similar; 27-JUN-12; KYNURENINE FORMAMIDASE;
DR PDB; 4E14; Highly similar; 27-JUN-12; KYNURENINE FORMAMIDASE;
DR PDB; 4E15; Highly similar; 27-JUN-12; KYNURENINE FORMAMIDASE;
DR KEGG; 3.; Enzyme page
DR FFAS; 371276; Fold and function assignment.
DR TVPC; YP_614486.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_614486.1; Ortholog view popup.
DR TPM; YP_614486.1; Target PDB monitor.
DR FSS; YP_614486.1; Target function coverage.
PROPERTY Residues: 261 aa
Molecule Weight: 28610.78 Dalton
Isoelectric Point: 4.76
Extinction Coefficient: 48930
Gravy Index: -.05
Number of Met residues: 7
Percentage of Met residues: 2.68 %
Number of Cys residues: 1
Percentage of Cys residues: 0.38 %
SEQUENCE  amino acids 261 aa
>YP_614486.1  gi|99082332|ref|YP_614486.1| putative esterase/lipase/thioesterase [Silicibacter sp. TM1040]
MELDDAYANGAYIEGAADYPPRWAASAEDFRNSLQDRARLNLSYGEGDRHKFDLFLPEGT
PVGLFVFVHGGYWMAFDKSSWSHLAVGALSKGWAVAMPSYELCPEVRISEITQQISQAVT
AAAKEIDGPIVLAGHSAGGHLVARMLDPEVLPEAVGARIRNVVPISPLSDLRPLLRTSMN
EKFKMDADAAIAESPVEMQNRYDAKVTVWVGGAERPAFLDQAIWLVEAWDADHVIAFEKH
HFNVIEPLADPESDLVAVITA

CDS  cDNA 786 bp
   1 atggaactcg acgacgccta tgccaacgga gcctatatcg aaggagccgc agactatcct    60
  61 ccgcgctggg cggcctccgc agaagatttc cgcaacagtc tgcaggaccg ggcgcgcttg   120
 121 aacctttctt atggcgaagg tgaccgacac aagtttgatt tgttcctgcc cgaaggcacc   180
 181 cccgtggggc tgtttgtctt tgtgcatggc gggtactgga tggcattcga taaatcgagc   240
 241 tggtcgcatc tggcggttgg ggcgctctca aaaggatggg cggtggcgat gccgtcatac   300
 301 gaactttgcc ccgaggtgcg catttccgag atcacgcagc agatttcgca ggctgtaacg   360
 361 gcagctgcaa aagagatcga tggtccgatc gttctggcgg gccactccgc cggggggcat   420
 421 ctggttgcgc ggatgcttga ccccgaagtg ctgccggagg ccgttggggc acgtattcgc   480
 481 aacgttgtgc cgatctctcc actctcagat ctgcgtccat tgctgcgcac ctcgatgaac   540
 541 gagaagttca agatggacgc cgacgccgcc attgctgaga gcccggtcga gatgcaaaac   600
 601 cgctatgacg ccaaagtgac cgtctgggtc ggcggggcgg agcggcccgc atttcttgat   660
 661 caggcgatct ggctggtgga agcctgggat gcggatcacg tcatcgcctt tgaaaaacac   720
 721 catttcaacg tgatcgaacc gcttgcggac ccagaaagcg atctggttgc ggtgataacc   780
 781 gcctga   786
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2632860 2633645 -3 Glimmer3 score 11.68 poor
Genemark probabilities .85   1 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu