LOADING...
   YP_614459.1;CM5490D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_614459.1    CM5490D            JCSG 369221 PDB Deposition 07-APR-05              PDB id: 2pfx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_614459.1
DESCRIPTIONuncharacterized peroxidase-related protein
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GDR9_SILST
DR SPTR;
DR GenBank; YP_614459
DR Pfam; PF02627; CMD;
DR PDB; 2PFX; Identical; 17-APR-07; UNCHARACTERIZED PEROXIDASE-RELATED PROTEIN;
DR PDB; 3C1L; Highly similar; 05-FEB-08; PUTATIVE ANTIOXIDANT DEFENSE PROTEIN MLR4105;
DR PDB; 2PRR; Highly similar; 29-MAY-07; ALKYLHYDROPEROXIDASE AHPD CORE: UNCHARACTERIZED P RELATED PR;
DR PDB; 2OYO; Highly similar; 20-MAR-07; UNCHARACTERIZED PEROXIDASE-RELATED PROTEIN;
DR FFAS; 369221; Fold and function assignment.
DR TVPC; YP_614459.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_614459.1; Ortholog view popup.
DR TPM; YP_614459.1; Target PDB monitor.
DR FSS; YP_614459.1; Target function coverage.
PROPERTY Residues: 190 aa
Molecule Weight: 21420.56 Dalton
Isoelectric Point: 5.27
Extinction Coefficient: 14440
Gravy Index: -.19
Number of Met residues: 13
Percentage of Met residues: 6.84 %
Number of Cys residues: 3
Percentage of Cys residues: 1.58 %
SEQUENCE  amino acids 190 aa
>YP_614459.1  gi|99082305|ref|YP_614459.1| Uncharacterised peroxidase-related [Silicibacter sp. TM1040]
MTKPKEPTALDLPMADPLPDETQKYFEICQEKLGMVPNVLKAYAFNVEKLNAFTAMYNDL
MLGESQLSKLEREMIAVVVSSINKCFYCLVAHGAAVRQLSGDPQLGEMLVMNYRVAPLDA
RQRVMLDFAAKMTRASAEIEEADREVLRSHGFNDRDIWDIANVTGFFNMTNRVASATAMM
PNAEYHGQFR

CDS  cDNA 573 bp
   1 atgacgaaac caaaggagcc aaccgcgcta gacctgccca tggctgatcc acttcccgac    60
  61 gagacacaga aatatttcga gatctgccaa gagaagctgg gcatggttcc aaatgtgctc   120
 121 aaggcttatg cctttaacgt cgagaagctg aatgccttca cggcgatgta taatgatctg   180
 181 atgcttgggg agagccaact ctccaagctg gagcgcgaga tgatcgcggt tgtggtttcc   240
 241 tcgatcaaca agtgctttta ttgcctcgta gcccatggtg cggcagtgcg acaattgtcc   300
 301 ggagatccgc aattgggcga gatgctggtg atgaactatc gtgttgcccc cttggatgcg   360
 361 cgtcagcgcg tgatgctgga cttcgcagcc aagatgaccc gcgcaagtgc cgagatcgaa   420
 421 gaggcggacc gcgaggtgct gcgcagccac ggtttcaacg atcgtgacat ttgggacatt   480
 481 gccaatgtca ccggcttctt caacatgaca aaccgtgtcg ccagcgccac tgccatgatg   540
 541 ccaaacgcag aataccacgg gcagtttcgg tga   573
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2606459 2607031 -2 Glimmer3 score 9.62 poor
Genemark probabilities .78   .06 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu