LOADING...
   YP_613385.1;FL11268A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_613385.1    FL11268A            JCSG 376409 PDB Deposition 07-AUG-10              PDB id: 2qwz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_613385.1
DESCRIPTIONPutative thioesterase [hot dog-like fold]
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GGU3_SILST
DR SPTR; Q1GGU3 (flat text); Q1GGU3 (good view)
DR GenBank; YP_613385
DR Pfam; PF03061; 4HBT;
DR PDB; 2QWZ; Identical; 21-AUG-07; PHENYLACETIC ACID DEGRADATION-RELATED PROTEIN;
DR KEGG; 3.; Enzyme page
DR FFAS; 376409; Fold and function assignment.
DR TVPC; YP_613385.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_613385.1; Ortholog view popup.
DR TPM; YP_613385.1; Target PDB monitor.
DR FSS; YP_613385.1; Target function coverage.
PROPERTY Residues: 140 aa
Molecule Weight: 15249.8 Dalton
Isoelectric Point: 5.68
Extinction Coefficient: 4470
Gravy Index: .07
Number of Met residues: 6
Percentage of Met residues: 4.29 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 140 aa
>YP_613385.1  gi|99081231|ref|YP_613385.1| Phenylacetic acid degradation-related protein [Silicibacter sp. TM1040]
MELVFDKDGLSAYLEEVFPQIQGEFSIDALAKGEITMRLNVQERHLRPGGTVSGPSMFAL
ADVSVYALVLAHLGREALAVTTNASLDFMRKPESGRDLLGQARLLKLGRTLAVGDILLFS
EGMEAPVARSTMTYSIPPKR

CDS  cDNA 423 bp
   1 atggaactgg tgtttgataa agacggcctc agcgcctatc tcgaggaggt ctttcctcag    60
  61 atacagggcg agttcagcat cgatgcgctt gcaaaaggcg agatcaccat gcgcctcaac   120
 121 gtgcaggagc ggcatttgcg tccgggagga acggtttcag gcccgtcgat gttcgcgctc   180
 181 gctgatgtct cggtctacgc cttggttttg gcgcacctcg gacgagaggc gctggcggtc   240
 241 acgaccaatg cctcgctcga ttttatgcgc aaacccgaaa gcggacgcga tctcttgggg   300
 301 caagcacgcc tgttgaaact ggggcgcaca ttggcagtcg gggatatcct gttgttctcc   360
 361 gaagggatgg aggccccggt cgcgcgctca accatgacct attccatccc gccgaaacgc   420
 421 taa   423
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1483581 1484003 -3 Glimmer3 score 9.73 poor
Genemark probabilities .78   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu