LOADING...
   YP_612389.1;FM11526A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_612389.1    FM11526A            JCSG 377806 PDB Deposition 07-NOV-21              PDB id: 3bfm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_612389.1
DESCRIPTIONBiotin protein ligase-like protein (YP_612389.1) is unlikely to have the same function as structurally similar proteins: 2eay, 1wnl, and 1bia.
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GJN9_SILST
DR SPTR; Q1GJN9 (flat text); Q1GJN9 (good view)
DR GenBank; YP_612389
DR PDB; 3BFM; Identical; 04-DEC-07; BIOTIN PROTEIN LIGASE-LIKE PROTEIN OF UNKNOWN FUN CHAIN: A;
DR FFAS; 377806; Fold and function assignment.
DR TVPC; YP_612389.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_612389.1; Ortholog view popup.
DR TPM; YP_612389.1; Target PDB monitor.
DR FSS; YP_612389.1; Target function coverage.
PROPERTY Residues: 234 aa
Molecule Weight: 25026.92 Dalton
Isoelectric Point: 4.35
Extinction Coefficient: 41480
Gravy Index: 0
Number of Met residues: 6
Percentage of Met residues: 2.56 %
Number of Cys residues: 5
Percentage of Cys residues: 2.14 %
SEQUENCE  amino acids 234 aa
>YP_612389.1  gi|99080235|ref|YP_612389.1| hypothetical protein TM1040_0394 [Silicibacter sp. TM1040]
MSETITFPPLMTGEAAGPGQDPFDLACQKAELGVDAGLVVYELGTDVLRAALVLAPEVPL
AKAMAMLPVCGVGFQNALGALAPPEVAVHLDWNGALRINGARCGRLRIAASTDDPDTQPD
WLVVGLDLPLWPEGDGGETPDETALYAEGCADVAAPRLLESWARHCLHWINRWDEGELET
IHGEWRGLAHGMGEARTEAGRSGTFLGVDEDFGMLLRDETTTHLIPLTTVLVQD

CDS  cDNA 705 bp
   1 atgagcgaga cgatcacctt ccctcccctg atgacggggg aggccgcagg cccgggacag    60
  61 gatccctttg accttgcatg ccagaaggca gaactcggtg tcgatgcggg gcttgtggtc   120
 121 tatgagctcg gaacagacgt gctgcgggcg gccctcgtgc tggcccccga ggtgccactc   180
 181 gccaaggcta tggcgatgct gccggtctgc ggggtcgggt tccagaacgc gcttggcgct   240
 241 ctcgctccgc cagaggtcgc ggtgcatctg gactggaacg gcgccctgcg catcaatggc   300
 301 gcacgctgtg gcagattgcg gatcgccgcc agcacagatg atccggacac gcaaccggac   360
 361 tggcttgtgg tggggctgga cctgccgctc tggcctgaag gcgatggcgg cgagaccccc   420
 421 gacgaaaccg cgctctatgc cgaaggctgt gctgatgttg ctgcaccgcg cctgctggaa   480
 481 agctgggcac gccattgcct gcattggatc aaccgatggg atgagggcga gcttgagacg   540
 541 atccacggcg aatggcgcgg ccttgcgcat ggcatgggcg aagcgcgcac cgaagccggg   600
 601 cgcagcggca cgttccttgg tgtagacgag gatttcggaa tgcttttgcg ggatgagacc   660
 661 accactcatc tgatcccgct caccaccgtt ctggtgcagg actga   705
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
402282 402986 -3 Glimmer3 score 12.67 good
Genemark probabilities .9   .66 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu