LOADING...
   YP_612366.1;FM11607A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_612366.1    FM11607A            JCSG 377904 PDB Deposition 08-FEB-13              PDB id: 3c8u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_612366.1
DESCRIPTIONputative fructose transport system kinase
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GJR2_SILST
DR SPTR; Q1GJR2 (flat text); Q1GJR2 (good view)
DR GenBank; YP_612366
DR PDB; 3C8U; Identical; 26-FEB-08; FRUCTOKINASE;
DR FFAS; 377904; Fold and function assignment.
DR TVPC; YP_612366.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_612366.1; Ortholog view popup.
DR TPM; YP_612366.1; Target PDB monitor.
DR FSS; YP_612366.1; Target function coverage.
PROPERTY Residues: 207 aa
Molecule Weight: 22503.43 Dalton
Isoelectric Point: 5.54
Extinction Coefficient: 24980
Gravy Index: -.08
Number of Met residues: 3
Percentage of Met residues: 1.45 %
Number of Cys residues: 3
Percentage of Cys residues: 1.45 %
SEQUENCE  amino acids 207 aa
>YP_612366.1  gi|99080212|ref|YP_612366.1| hypothetical protein TM1040_0371 [Silicibacter sp. TM1040]
MTLAALCQGVLERLDPRQPGRQLVALSGAPGSGKSTLSNPLAAALSAQGLPAEVVPMDGF
HLDNRLLEPRGLLPRKGAPETFDFEGFQRLCHALKHQERVIYPLFDRARDIAIAGAAEVG
PECRVAIIEGNYLLFDAPGWRDLTAIWDVSIRLEVPMADLEARLVQRWLDHGLNHDAAVA
RAQGNDLANARAIEAARLPADLTWPQA

CDS  cDNA 624 bp
   1 atgaccctcg cggcgctctg ccaaggcgtt ctggagcggc tcgaccctcg ccagccggga    60
  61 cgacagttgg tggctctctc cggggcgccc ggaagcggca agtccaccct gtccaacccg   120
 121 ctggccgccg ctctgagcgc gcaggggctc cctgctgagg tggtgccgat ggatgggttt   180
 181 cacctcgaca atcgcctgtt ggagccacgc gggctgctgc ctcgcaaagg cgcaccagaa   240
 241 acctttgatt tcgaggggtt ccagcgcctg tgccatgcgt tgaaacacca agagcgtgtg   300
 301 atctacccgc tctttgaccg ggcgcgcgac attgccatag cgggtgcggc cgaggtcggg   360
 361 ccggaatgtc gtgtggcgat catcgaaggc aactatctgt tgtttgacgc gccgggttgg   420
 421 cgcgatctga ctgccatctg ggacgtgtcg atccggcttg aggttccaat ggcggatctt   480
 481 gaggcgcggc tggtgcagcg ttggctggat cacgggctga atcatgacgc ggcggtggcg   540
 541 cgggcgcagg gcaatgacct ggcaaatgcg cgcgcgatcg aggccgcgcg cctgccggcg   600
 601 gaccttacat ggccgcaggc ctga   624
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
381014 381637 2 Glimmer3 score 10.28 poor
Genemark probabilities .74   .94 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu