LOADING...
   YP_612324.1;FP8022C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_612324.1    FP8022C            JCSG 383406 PDB Deposition 11-JUN-20              PDB id: 3oru, 3siy

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_612324.1
DESCRIPTIONDUF1989 family protein, PF09347, concanavalin A-like lectins/glucanases fold
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GJV4_SILST
DR SPTR; Q1GJV4 (flat text); Q1GJV4 (good view)
DR GenBank; YP_612324
DR Pfam; PF09347; DUF1989;
DR PDB; 3ORU; Identical; 13-OCT-10; DUF1989 FAMILY PROTEIN;
DR PDB; 3SIY; Identical; 13-JUL-11; DUF1989 FAMILY PROTEIN;
DR FFAS; 383406; Fold and function assignment.
DR TVPC; YP_612324.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_612324.1; Ortholog view popup.
DR TPM; YP_612324.1; Target PDB monitor.
DR FSS; YP_612324.1; Target function coverage.
PROPERTY Residues: 233 aa
Molecule Weight: 25835 Dalton
Isoelectric Point: 5.82
Extinction Coefficient: 22460
Gravy Index: -.35
Number of Met residues: 8
Percentage of Met residues: 3.43 %
Number of Cys residues: 6
Percentage of Cys residues: 2.58 %
SEQUENCE  amino acids 233 aa
>YP_612324.1  gi|99080170|ref|YP_612324.1| hypothetical protein TM1040_0329 [Silicibacter sp. TM1040]
MTSFDRPFEAARPDGENPSAHETLAEGGRLRPEATYTIPARQGRAIRMAQGEALMVINRD
GSQIGDFWAFVEGDCGEYLSMEHLRPTLRRVSPRPGDVLVSNRRRPILTLLEDSSPGVHD
TLVASCDVHRYAQLGHEGYHDNCTDNLRMALGALGLRPTTVPCPLNLWMNTPVVEGGAME
WRPPVSRRGDHVLFRAELDVVVVISCCPMDLLPINGEEAQPRALDVRLRPRPA

CDS  cDNA 702 bp
   1 atgaccagtt ttgaccgccc ctttgaggcc gcgcggcccg atggcgaaaa cccaagcgcc    60
  61 catgagacgc tggcagaagg cggacgactg cgtcccgagg cgacctatac cattcctgcc   120
 121 cgacaggggc gggcgatccg catggcacag ggggaggcct tgatggtcat caaccgggat   180
 181 ggcagccaga tcggggattt ctgggccttt gtggagggtg actgtggcga gtacctgtca   240
 241 atggagcacc tgcgcccgac gttgaggcgc gtctcgccgc gtcccggcga tgtgctggtg   300
 301 agcaatcgcc gccgtccgat cctgacgttg ctggaggata gttcgcccgg ggtccacgac   360
 361 acgcttgtgg cctcctgcga tgtgcatcgc tacgcgcagc ttgggcatga gggctatcac   420
 421 gacaattgca ccgacaacct gcgcatggcg ctgggcgcgc tgggtctgcg cccgaccacg   480
 481 gtgccttgtc cgctgaacct ctggatgaac acccccgtgg tcgagggcgg cgcgatggaa   540
 541 tggcgccctc cggtctcacg caggggggac catgtgctgt ttcgcgcgga actggatgtc   600
 601 gtggtggtga tttcctgctg cccgatggat ctcttgccaa tcaacggtga ggaggcgcag   660
 661 ccccgcgcgc tggatgtgcg gctgcgccca aggcccgcgt ga   702
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
334033 334734 1 Glimmer3 score 11.29 poor
Genemark probabilities .85   .95 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu