LOADING...
   YP_611791.1;MG14561D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_611791.1    MG14561D            JCSG 391384 PDB Deposition 08-NOV-12              PDB id: 3f8h

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_611791.1
DESCRIPTIONPutative polyketide cyclase. Analysis of genomic neighborhood and phylogenetic profiles indicate that this protein may be functionally associated with nitrilases that break carbon-nitrogen bonds.
ORGANISMSilicibacter sp. tm1040
COMMENT 
DR UNIPROT; Q1GLD7_SILST
DR SPTR; Q1GLD7 (flat text); Q1GLD7 (good view)
DR GenBank; YP_611791
DR PDB; 3F8H; Identical; 25-NOV-08; PUTATIVE POLYKETIDE CYCLASE;
DR PDB; 3I0Y; Highly similar; 21-JUL-09; PUTATIVE POLYKETIDE CYCLASE;
DR PDB; 3F7X; Highly similar; 25-NOV-08; PUTATIVE POLYKETIDE CYCLASE;
DR FFAS; 391384; Fold and function assignment.
DR TVPC; YP_611791.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_611791.1; Ortholog view popup.
DR TPM; YP_611791.1; Target PDB monitor.
DR FSS; YP_611791.1; Target function coverage.
PROPERTY Residues: 131 aa
Molecule Weight: 14573.45 Dalton
Isoelectric Point: 4.79
Extinction Coefficient: 15930
Gravy Index: -.28
Number of Met residues: 4
Percentage of Met residues: 3.05 %
Number of Cys residues: 3
Percentage of Cys residues: 2.29 %
SEQUENCE  amino acids 131 aa
>YP_611791.1  gi|99078533|ref|YP_611791.1| hypothetical protein TM1040_3560 [Silicibacter sp. TM1040]
MNDTIARYFDAFNAGDTDGMLACLSEDVAHHVNEGNIRVGKEKFAAFCAHMSHCYKEELT
DMVIFATPDATRAAAEYTVNGTYLATDEGLPEARQQSYKLPAGSFFDLRDGLITRVTTYY
NLSDWIKQVSA

CDS  cDNA 396 bp
   1 atgaacgaca cgatcgcgcg ctattttgac gctttcaacg caggcgacac cgatggaatg    60
  61 cttgcatgcc tgtccgagga cgtggcgcat cacgtcaacg agggcaacat ccgcgtcggc   120
 121 aaagagaaat tcgccgcctt ctgcgcgcat atgagccact gctacaaaga agagctgacc   180
 181 gatatggtca tctttgcaac gccggacgca acgcgcgcgg cagccgaata cactgtgaac   240
 241 ggcacctatc ttgcaacaga tgaaggcctg cccgaagccc gacagcagag ctataaactc   300
 301 ccggctgggt cgttctttga cctgcgcgac gggctcatca cccgcgtgac cacctattac   360
 361 aatctctccg actggatcaa acaggtctcg gcctga   396
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu