LOADING...
   YP_400729.1;PE00037E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_400729.1    PE00037E            JCSG 368396 PDB Deposition 06-NOV-13              PDB id: 2nvn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_400729.1
DESCRIPTIONcupin-like fold
ORGANISMSynechococcus sp. pcc 7942 (elongatus)
COMMENT 
DR UNIPROT; Q31MH7_SYNP7
DR SPTR;
DR GenBank; YP_400729
DR Pfam; PF08848; DUF1818;
DR PDB; 2NVN; Identical; 12-DEC-06; HYPOTHETICAL PROTEIN;
DR FFAS; 368396; Fold and function assignment.
DR TVPC; YP_400729.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_400729.1; Ortholog view popup.
DR TPM; YP_400729.1; Target PDB monitor.
DR FSS; YP_400729.1; Target function coverage.
PROPERTY Residues: 121 aa
Molecule Weight: 13321.48 Dalton
Isoelectric Point: 4.59
Extinction Coefficient: 30480
Gravy Index: .14
Number of Met residues: 3
Percentage of Met residues: 2.48 %
Number of Cys residues: 2
Percentage of Cys residues: 1.65 %
SEQUENCE  amino acids 121 aa
>YP_400729.1  gi|81300521|ref|YP_400729.1| hypothetical protein Synpcc7942_1712 [Synechococcus elongatus PCC 7942]
MGRILREGAGWRLGWDETAHRYPGLVGTTDWAVELTAAEMADFCRLVQQLAETIAAIAPE
LMPEERLQIEAESALLWLEAEGFADAYELRLILASDRRVEACWPAAAVPALVAATHTLKG
F

CDS  cDNA 366 bp
   1 atgggccgaa ttctccgaga aggcgctggt tggcgcttgg gttgggatga gactgcccat    60
  61 cgctatccgg gtctggtggg aaccacagat tgggcagttg aactgaccgc cgctgagatg   120
 121 gcggattttt gtcgactcgt gcagcaactc gctgaaacga tcgctgcgat tgcccctgaa   180
 181 ttgatgcccg aggaacgcct gcagattgag gctgagtccg ccttgctctg gctggaggca   240
 241 gaaggttttg cagatgccta cgagctgcgt ctgatcctcg ccagcgatcg ccgagtcgaa   300
 301 gcgtgctggc ccgccgctgc ggttccggct ctcgtggccg caactcatac cctcaaaggc   360
 361 ttctag   366
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1780853 1781218 2 Glimmer3 score 11.17 poor
Genemark probabilities .82   .83 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu