LOADING...
   YP_399305.1;PE00042D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_399305.1    PE00042D            JCSG 368393 PDB Deposition 10-JUL-30              PDB id: 2l1n

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_399305.1
DESCRIPTIONNMR structure of DUF1823 family protein, PF08853
ORGANISMSynechococcus sp. pcc 7942 (elongatus)
COMMENT 
DR UNIPROT; Q31RK1_SYNP7
DR SPTR;
DR GenBank; YP_399305
DR Pfam; PF08853; DUF1823;
DR PDB; 2L1N; Identical; 18-AUG-10; UNCHARACTERIZED PROTEIN;
DR FFAS; 368393; Fold and function assignment.
DR TVPC; YP_399305.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_399305.1; Ortholog view popup.
DR TPM; YP_399305.1; Target PDB monitor.
DR FSS; YP_399305.1; Target function coverage.
PROPERTY Residues: 120 aa
Molecule Weight: 13842.01 Dalton
Isoelectric Point: 5.01
Extinction Coefficient: 40450
Gravy Index: -.42
Number of Met residues: 2
Percentage of Met residues: 1.67 %
Number of Cys residues: 1
Percentage of Cys residues: 0.83 %
SEQUENCE  amino acids 120 aa
>YP_399305.1  gi|81299097|ref|YP_399305.1| hypothetical protein Synpcc7942_0286 [Synechococcus elongatus PCC 7942]
MGITITDELLWAILKDELSDAEANALVWQALGYVWDEAQSCWKTDLVAPEWRQDYPEPPD
FIASRPATVKLTRSIPAPYKQLLKEELGFAGYSINELVPRKTRRATMTNWLLAYRRSQQD

CDS  cDNA 363 bp
   1 atgggcatca caattactga tgagttgctt tgggccatcc tcaaagatga gctgtcggat    60
  61 gccgaagcca atgctttggt ttggcaggct ttgggctatg tctgggatga agcccaatcc   120
 121 tgttggaaaa cggacctagt cgcccctgag tggcgacagg attatccaga gccgcccgac   180
 181 tttattgcta gtcggcctgc cacggtcaaa ttaacgcgat cgattccagc accttataaa   240
 241 caactgctca aagaggagct aggatttgcg ggttactcga tcaatgaatt ggtgcctcgc   300
 301 aaaacccgcc gcgccacgat gaccaattgg cttttggcct atcggcgatc gcaacaagac   360
 361 tag   363
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
281480 281842 2 Glimmer3 score 12.17 good
Genemark probabilities .72   .85 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu