LOADING...
   YP_390128.1;FM11964A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_390128.1    FM11964A            JCSG 377310 PDB Deposition 08-FEB-13              PDB id: 3c8v

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_390128.1
DESCRIPTIONputative acetyltransferase
ORGANISMDesulfovibrio desulfuricans g20
COMMENT 
DR UNIPROT; Q30V63_DESDG
DR SPTR; Q30V63 (flat text); Q30V63 (good view)
DR GenBank; YP_390128
DR PDB; 3C8V; Identical; 26-FEB-08; PUTATIVE ACETYLTRANSFERASE;
DR FFAS; 377310; Fold and function assignment.
DR TVPC; YP_390128.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_390128.1; Ortholog view popup.
DR TPM; YP_390128.1; Target PDB monitor.
DR FSS; YP_390128.1; Target function coverage.
PROPERTY Residues: 477 aa
Molecule Weight: 52867.88 Dalton
Isoelectric Point: 5.85
Extinction Coefficient: 41830
Gravy Index: -.26
Number of Met residues: 11
Percentage of Met residues: 2.31 %
Number of Cys residues: 6
Percentage of Cys residues: 1.26 %
SEQUENCE  amino acids 477 aa
>YP_390128.1  gi|78358679|ref|YP_390128.1| hypothetical protein Dde_3640 [Desulfovibrio desulfuricans G20]
MTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHYSKFYAFYGLSADDPVHFHFKN
SSLAGSYLLGRVNVLHSALYKSDIRGDELKRKGQHFVCDGKMIPLHDDEVITIKDSFLNK
TLVHSNSHDPESPEEFTIRNTVAMPYANIHGSLTEGSFIGSFATVDLSTIHNSVVRYFSY
VQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQE
DFEEVFASGHMASGAGSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQE
NCYIINSRLERNCVTAHGGKIINAHLGDMIFTGFNSFLQGSESSPLKIGDGCVVMPHTII
DLEEPLEIPAGHLVWGYIRNKADLAAHSISFEEFAKVDGEVTMGRMTFRGKGGPFLDSFK
KRIKRILSENGAFFDGSEGTGHAQKGKNFTFNIIQPYQDGDPRGMYPTILIQPNNGS

CDS  cDNA 1434 bp
   1 atgacgcagc tggaattgct tctggagcgc atcattgacc gggtgaacgt caaccttcgc    60
  61 catcagaagt ttgacgtggg cgactacgtg cgccggcaga cgccgcacct gcattactcg   120
 121 aagttctatg cattctacgg cctttcggcc gatgaccccg tgcatttcca cttcaagaac   180
 181 tcgagtcttg ccggcagcta cttactgggc cgtgtcaacg tgctgcattc tgcgttgtac   240
 241 aagagcgata tccgcggtga cgaactgaag cgcaagggtc agcattttgt ctgcgacggc   300
 301 aagatgattc ctctgcatga cgacgaggtc atcaccatca aggacagctt tctgaacaag   360
 361 acgctggtgc attccaactc gcacgatccg gaatcgccgg aagagttcac catccgcaac   420
 421 accgtggcca tgccttatgc aaacatccac ggttcgctta cggaaggcag cttcatcggg   480
 481 tcctttgcca cggtggacct ttccaccatc cacaacagcg tggtgcgcta cttctcgtat   540
 541 gtgcagacag gcgaactggt gggcaaatgc gtggaacccg gacagatatg gataaagagc   600
 601 ggtgatgagc tggagttcca ctacagcttt gataaagcca ttcttgacaa gtacatatcg   660
 661 caggaagccg gttcctgccc cacaggcgtc ctcatggagt ttgtggaagt gcggcaggag   720
 721 gatttcgagg aggtctttgc ctcgggtcat atggccagcg gcgccggttc ggcttccggt   780
 781 gcgtccgtca gcggatatgc cgtcataaaa ggcgacaccg tcatcggcga aaatgtgctg   840
 841 gtgtcacagc gcgcctatct ggataacgca tggatgggca agggcagcaa cgcgcaggaa   900
 901 aactgctaca tcatcaacag ccgtctggaa cgcaactgcg tcactgccca cggcggaaag   960
 961 atcatcaacg cgcatctggg cgacatgatc ttcaccgggt tcaactcgtt cctgcagggc  1020
1021 agcgaaagca gtccgctgaa aatcggtgac ggatgcgtgg tcatgccgca caccatcatc  1080
1081 gatctggaag agccgctgga aattccggcc ggtcaccttg tgtggggata tatccgcaac  1140
1141 aaggccgatc tggctgccca ttccatcagc tttgaagagt ttgccaaagt ggacggtgaa  1200
1201 gtgaccatgg gtcgtatgac cttccgcggc aagggcggcc cgttccttga ttccttcaaa  1260
1261 aagcgcatca aacgtattct cagcgaaaac ggtgcatttt ttgatggcag cgaaggcaca  1320
1321 ggacacgcac agaagggtaa gaacttcacg ttcaacatca tccagcccta tcaggacggt  1380
1381 gacccgcgcg gcatgtatcc gaccattctc attcagccca acaacggctc ctag  1434
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3603752 3605185 -2 Glimmer3 score 14.39 good
Genemark probabilities .95   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu