LOADING...
   YP_388986.1;PJ02661R
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_388986.1    PJ02661R            JCSG 374857 PDB Deposition 14-SEP-30              PDB id: 4rgl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_388986.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMDesulfovibrio desulfuricans g20
COMMENT 
DR UNIPROT; Q30YF5_DESDG
DR SPTR;
DR GenBank; YP_388986
DR Pfam; PF02661; Fic;
DR PDB; 4RGL; Identical; 29-OCT-14; FILAMENTATION INDUCED BY CAMP PROTEIN FIC;
DR PDB; 4U04; Highly similar; 10-DEC-14; ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE FICD;
DR PDB; 4U07; Highly similar; 10-DEC-14; ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE FICD;
DR PDB; 4U0U; Highly similar; 10-DEC-14; ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE FICD;
DR PDB; 4U0Z; Highly similar; 10-DEC-14; ADENOSINE MONOPHOSPHATE-PROTEIN TRANSFERASE FICD;
DR FFAS; 374857; Fold and function assignment.
DR TVPC; YP_388986.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_388986.1; Ortholog view popup.
DR TPM; YP_388986.1; Target PDB monitor.
DR FSS; YP_388986.1; Target function coverage.
PROPERTY Residues: 342 aa
Molecule Weight: 38773.84 Dalton
Isoelectric Point: 5.3
Extinction Coefficient: 49390
Gravy Index: -.37
Number of Met residues: 9
Percentage of Met residues: 2.63 %
Number of Cys residues: 1
Percentage of Cys residues: 0.29 %
SEQUENCE  amino acids 342 aa
>YP_388986.1  gi|78357537|ref|YP_388986.1| hypothetical protein Dde_2494 [Desulfovibrio desulfuricans G20]
MIKPSNYQPPYTITPAIVNLVAEIGEIIGRYTVLAEQNLTPRLRRENRIRTIQASLAIEN
NTLTLEQVTAVIDGKRVLGHPREIQEVRNAFATYEAMEDWDASVEGDLLAAHELLMRGLV
DETGRYRSGGVGIFRGEQLVHMAPPADRVPKLMADLLDWLENTNEHPLVASCIFHYEFEF
IHPFADGNGRMGRLWQTLILRNWKPLLAYLPVETVIRDRQEDYYRVLAVADSQADATPFV
EFMLGALRDAVREAVSTDHVGDQVTDQVAALIRAIGGGELSSNDLMQALGLSHRPTFRNN
YLNPAMEDEWIERTQPDSPRSPTQRYRLTGKGQRWLQHHADE

CDS  cDNA 1029 bp
   1 atgatcaagc cctccaacta ccagccaccc tacaccatta ccccggcgat agtgaatctg    60
  61 gtcgccgaga taggcgagat catcggccgc tacaccgtgc tggccgaaca gaacctgacg   120
 121 ccgcgcctgc gccgggagaa ccgcatccgt accatccagg cctcgctggc cattgagaac   180
 181 aatacgctca cccttgaaca ggtgaccgcc gtgatcgatg gcaaacgggt gttgggtcac   240
 241 ccccgcgaga ttcaggaggt gcgtaacgcc tttgcgacct acgaggccat ggaggactgg   300
 301 gacgccagtg tcgaggggga tttgctggcg gcacacgagt tgttgatgcg tgggctggtg   360
 361 gatgaaacgg gtcgatatcg atccggcggg gtcggcatct tccggggaga gcagttagtt   420
 421 cacatggctc ctcctgctga tcgtgtgccc aagcttatgg cggatctcct ggattggctg   480
 481 gaaaacacca acgagcatcc cttggtggcc agttgcattt ttcactacga gttcgaattc   540
 541 atccacccct ttgccgacgg taacggccgc atgggtcggt tgtggcaaac cctgattcta   600
 601 cgaaactgga agccgctgct ggcctacctg ccggtggaga cagtgatccg tgatcgccag   660
 661 gaagattatt accgggtact cgcggtcgcc gacagccaag cggatgccac tccttttgtc   720
 721 gagttcatgt tgggggcgtt gcgcgatgcc gtgcgcgagg ctgtgtcgac cgaccatgta   780
 781 ggcgaccaag taaccgacca agtagcggcg ttgatccgtg cgattggggg cggtgagctg   840
 841 agcagcaacg atttgatgca ggctttaggt ttgtcacacc ggcccacgtt ccgtaacaac   900
 901 tacctcaacc cggccatgga agacgaatgg atcgaacgta cccaacccga ttccccgcgc   960
 961 agcccgactc agcgctatcg gttgaccggt aaaggccagc gttggctgca acaccatgcc  1020
1021 gacgagtag  1029
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2515761 2516789 -3 Glimmer3 score 3.23 poor
Genemark probabilities .64   .61 poor
GenemarkHMM class 2 poor

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu