LOADING...
   YP_324426.1;MI15921E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_324426.1    MI15921E            JCSG 399397 PDB Deposition 10-SEP-10              PDB id: 3ot2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_324426.1
DESCRIPTIONPutative nuclease [Restriction endonuclease-like]
ORGANISMAnabaena variabilis atcc 29413
COMMENT 
DR UNIPROT; Q3M655_ANAVT
DR SPTR; Q3M655 (flat text); Q3M655 (good view)
DR GenBank; YP_324426
DR Pfam; PF05685; Uma2;
DR PDB; 3OT2; Identical; 06-OCT-10; UNCHARACTERIZED PROTEIN;
DR FFAS; 399397; Fold and function assignment.
DR TVPC; YP_324426.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_324426.1; Ortholog view popup.
DR TPM; YP_324426.1; Target PDB monitor.
DR FSS; YP_324426.1; Target function coverage.
PROPERTY Residues: 186 aa
Molecule Weight: 21122.12 Dalton
Isoelectric Point: 4.91
Extinction Coefficient: 24980
Gravy Index: -.16
Number of Met residues: 3
Percentage of Met residues: 1.61 %
Number of Cys residues: 3
Percentage of Cys residues: 1.61 %
SEQUENCE  amino acids 186 aa
>YP_324426.1  gi|75910130|ref|YP_324426.1| Protein of unknown function DUF820 [Anabaena variabilis ATCC 29413]
MVQTPSKPITLDEFLKLPETEPASEYIEGKIIQKPMPQGKHSAIQSECVSVINSVVKPQR
IARAFLELRCTFGDHSTVPDISVFIWSRIPREENGEIANIFLIAPDWTIEILSPDQSQTK
VTKNILHCLKHGTQMGWLIDPDEQTVFVYRPQQETEVFDEPDALVPVPSFASELHLSIKD
LFSWLL

CDS  cDNA 561 bp
   1 atggtacaga ccccatccaa acccatcaca ttggacgagt tcctgaaatt accagaaact    60
  61 gaacccgcca gtgaatacat agaaggtaaa attatccaaa aacctatgcc gcaaggaaag   120
 121 cacagtgcaa tacaaagtga atgtgtatct gttattaata gtgtagttaa acctcaacgt   180
 181 atcgctcgtg cttttcttga actgcgttgt acatttggcg atcattcaac tgtacctgat   240
 241 atttccgtct ttatttggag tcggattccc cgcgaagaga atggggaaat tgctaatatt   300
 301 tttcttattg ctcccgattg gacaattgaa attttatcac ctgatcaaag tcagacgaaa   360
 361 gtaactaaaa atatccttca ttgtttgaaa catggtactc aaatgggttg gttaattgac   420
 421 cccgatgagc aaactgtatt tgtttaccgt cctcaacaag aaactgaagt atttgatgag   480
 481 ccagatgcac tcgtacctgt accatccttt gcgagtgaac ttcatctgag tattaaagat   540
 541 ttgtttagtt ggttgcttta g   561
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
4880072 4880632 -2 Glimmer3 score 6.42 poor
Genemark probabilities .8   - poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu