LOADING...
   YP_315894.1;MG11810B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_315894.1    MG11810B            JCSG 396994 PDB Deposition 09-APR-01              PDB id: 3gwr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_315894.1
DESCRIPTIONPutative calcium/calmodulin-dependent protein
ORGANISMThiobacillus denitrificans atcc 25259
COMMENT 
DR UNIPROT; Q3SH04_THIDA
DR SPTR; Q3SH04 (flat text); Q3SH04 (good view)
DR GenBank; YP_315894
DR PDB; 3GWR; Identical; 14-APR-09; PUTATIVE CALCIUM/CALMODULIN-DEPENDENT PROTEIN KIN II ASSOCIA;
DR KEGG; 2.7.11.17; Enzyme page
DR FFAS; 391529; Fold and function assignment.
DR TVPC; YP_315894.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_315894.1; Ortholog view popup.
DR TPM; YP_315894.1; Target PDB monitor.
DR FSS; YP_315894.1; Target function coverage.
PROPERTY Residues: 143 aa
Molecule Weight: 15666 Dalton
Isoelectric Point: 5.94
Extinction Coefficient: 19480
Gravy Index: -.03
Number of Met residues: 5
Percentage of Met residues: 3.50 %
Number of Cys residues: 1
Percentage of Cys residues: 0.70 %
SEQUENCE  amino acids 143 aa
>YP_315894.1  gi|74318154|ref|YP_315894.1| hypothetical protein Tbd_2136 [Thiobacillus denitrificans ATCC 25259]
MSEPVFPTPEAAEEAFYAAFEARSLDDMMAVWARDDHVACIHPLAAPLNGRAAVAAGWRS
MFGAAGRFRLQVKAVHEIRQADHVIRIVDEFLTIGDETAPRPAILATNVYRREADGWRMV
LHHASPLQVGAKAGADTPPVVFH

CDS  cDNA 432 bp
   1 atgtccgaac ctgtcttccc cacccccgaa gccgccgaag aggctttcta cgccgccttc    60
  61 gaagcgcggt cgctcgacga catgatggcg gtctgggcac gtgacgacca cgtcgcctgc   120
 121 atacacccgc ttgccgcgcc gctcaatggg cgcgcggcgg tggcggcggg ctggcgaagc   180
 181 atgttcggcg ccgcgggacg cttccgcctg caggtgaagg cggtccacga aatacgccaa   240
 241 gccgaccacg tgatccgcat cgtcgacgaa ttcctcacca tcggcgacga gacggcgccg   300
 301 cgcccggcga ttctcgcgac caacgtctat cgacgcgaag ccgacggctg gcgcatggtc   360
 361 ctccatcacg cgtcgccctt gcaggtcggc gcgaaggccg gcgccgacac gccgcccgtc   420
 421 gtattccact aa   432
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2222095 2222526 1 Glimmer3 score 9.87 poor
Genemark probabilities .78   .43 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu