LOADING...
   YP_290923.1;PJ04672A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_290923.1    PJ04672A            JCSG 375255 PDB Deposition 07-JUN-22              PDB id: 2qe6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_290923.1
DESCRIPTIONPutative methyltransferase
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT; Q47KX2_THEFY
DR SPTR; Q47KX2 (flat text); Q47KX2 (good view)
DR GenBank; YP_290923
DR Pfam; PF04672; Methyltransf_19;
DR PDB; 2QE6; Identical; 03-JUL-07; UNCHARACTERIZED PROTEIN TFU_2867;
DR PDB; 3GIW; Highly similar; 14-APR-09; PROTEIN OF UNKNOWN FUNCTION DUF574;
DR PDB; 3GO4; Highly similar; 14-APR-09; PROTEIN OF UNKNOWN FUNCTION DUF574;
DR KEGG; 2.-.-.-; Enzyme page
DR FFAS; 374234; Fold and function assignment.
DR TVPC; YP_290923.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_290923.1; Ortholog view popup.
DR TPM; YP_290923.1; Target PDB monitor.
DR FSS; YP_290923.1; Target function coverage.
PROPERTY Residues: 273 aa
Molecule Weight: 29986.37 Dalton
Isoelectric Point: 4.95
Extinction Coefficient: 28420
Gravy Index: -.24
Number of Met residues: 7
Percentage of Met residues: 2.56 %
Number of Cys residues: 1
Percentage of Cys residues: 0.37 %
SEQUENCE  amino acids 273 aa
>YP_290923.1  gi|72163266|ref|YP_290923.1| hypothetical protein Tfu_2867 [Thermobifida fusca YX]
MSDEQHDSVWPPPGLDFSKPTIARAYDALLGGKDNFEADRALADYACKHIPGLKESAIEN
RKVLVRGVRFLAGEAGISQFLDLGSGLPTVQNTHEVAQSVNPDARVVYVDIDPMVLTHGR
ALLAKDPNTAVFTADVRDPEYILNHPDVRRMIDFSRPAAIMLVGMLHYLSPDVVDRVVGA
YRDALAPGSYLFMTSLVDTGLPAQQKLARITRENLGEGWARTPEEIERQFGDFELVEPGV
VYTALWRPDEPVDPDNLSPGEQLGMAGIGRKKA

CDS  cDNA 822 bp
   1 atgagcgacg agcagcacga ctccgtgtgg ccgcccccag ggctcgactt ctccaagccc    60
  61 acgatagccc gcgcctacga tgcgctactc ggtggcaagg acaacttcga agccgaccgg   120
 121 gccttggcgg actacgcctg taagcacatt cccgggctca aagaatcggc tatcgaaaac   180
 181 cggaaggtcc tggtccgcgg agtgaggttc ctcgccggtg aggcagggat cagccaattc   240
 241 ctggacttgg gcagcgggtt gcccactgtg cagaacacgc acgaagttgc ccagtcggtc   300
 301 aaccctgatg cgcgcgtggt ctacgtggac atcgacccga tggtgctcac ccacggtcgg   360
 361 gcgttgctgg caaaagaccc caacaccgcg gtgttcaccg cagatgtccg cgacccggag   420
 421 tacattctca accatcccga tgtgcgccgc atgatcgact tcagccgtcc agcagcaatc   480
 481 atgctggtgg gcatgctgca ctatctctcc cctgatgttg tggacagggt ggtgggcgct   540
 541 tatcgggacg cactggcacc gggcagctac cttttcatga cttccctggt ggacacgggg   600
 601 cttcccgcac agcagaaact ggctcggatc actcgggaga acctcggcga agggtgggcg   660
 661 cgcacccccg aggagattga acgccagttc ggcgactttg aacttgtgga gcccggcgtc   720
 721 gtctacaccg cgctgtggcg tcctgacgag ccggttgacc cggacaacct ctccccgggg   780
 781 gagcagttgg gaatggctgg aatcggccgt aagaaggcct ga   822
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3374477 3375298 2 Glimmer3 score 12.06 good
Genemark probabilities .8   .98 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu