LOADING...
   YP_290749.1;PC00329C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_290749.1    PC00329C            JCSG 372019 PDB Deposition 10-MAR-29              PDB id: 3mcr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_290749.1
DESCRIPTIONNADH dehydrogenase subunit C [Nqo5-like]
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT; Q47LE6_THEFY
DR SPTR;
DR GenBank; YP_290749
DR Pfam; PF00329; Complex1_30kDa;
DR PDB; 3MCR; Identical; 12-MAY-10; NADH DEHYDROGENASE, SUBUNIT C;
DR KEGG; 1.6.-.-; Enzyme page
DR FFAS; 361174; Fold and function assignment.
DR TVPC; YP_290749.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_290749.1; Ortholog view popup.
DR TPM; YP_290749.1; Target PDB monitor.
DR FSS; YP_290749.1; Target function coverage.
PROPERTY Residues: 252 aa
Molecule Weight: 28534.35 Dalton
Isoelectric Point: 5.83
Extinction Coefficient: 34380
Gravy Index: -.69
Number of Met residues: 4
Percentage of Met residues: 1.59 %
Number of Cys residues: 2
Percentage of Cys residues: 0.79 %
SEQUENCE  amino acids 252 aa
>YP_290749.1  gi|72163092|ref|YP_290749.1| NADH dehydrogenase subunit C [Thermobifida fusca YX]
MTSNGQQGKPNLPEKDNLPRELGTQRINSPIARMGMFGAKTTGDTSGYGRLRVYRHVPAA
AQRPYSDPSDPRTAYFDEVADALERSLKEIGTPYDTAISRVVVDRGEITFHVQREHLLDV
ATRLRDDPALRFELCLGVTGVHYPEDEGNELHAVYALRSITHNYEIRLEVSCPDSDPHIP
SIVSVYPTNDWHEREAWDFFGIIFDGHPALTRIHMPDDWHGHPQRKDYPLGGIPVEYRGA
KVPPPDQRRSYA

CDS  cDNA 759 bp
   1 atgacctcca acgggcagca aggcaagcct aacctaccag aaaaggacaa ccttcccaga    60
  61 gagctgggga cgcagcgcat caattcgccg atcgcccgca tgggcatgtt cggtgccaaa   120
 121 accaccggcg acacgtccgg ctacggacgg ctgcgcgtct accggcacgt gcccgccgcc   180
 181 gcccagcgtc cctacagcga ccccagcgac ccgcgcacgg cctacttcga cgaagtcgcc   240
 241 gacgcgctcg aacgctccct gaaagagatc gggacaccct acgacaccgc gatcagccgg   300
 301 gtcgtggtgg accgcggcga gatcaccttc cacgtgcagc gcgaacacct gctggacgtg   360
 361 gccacccggc tgcgcgacga tccggcgctc cgtttcgaac tgtgcctggg ggtcaccggg   420
 421 gtccactacc ccgaggatga gggcaacgaa ctgcacgccg tctacgcgtt gcgctccatc   480
 481 acgcacaact acgagatccg gctcgaagtg agctgccccg actcggaccc gcacatcccc   540
 541 tcgatcgtga gcgtctaccc caccaacgac tggcacgaac gagaggcctg ggacttcttc   600
 601 gggatcatct tcgacggcca ccccgccctc acccgtatcc acatgcccga cgactggcac   660
 661 ggccatcccc agcgcaagga ctacccgctg ggcggaattc cggtcgagta ccgcggggcc   720
 721 aaggttcccc cgccggacca gcggaggtcg tacgcatga   759
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3169717 3170475 -1 Glimmer3 score 10.43 poor
Genemark probabilities .83   .05 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu