LOADING...
   YP_290423.1;FK9593A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_290423.1    FK9593A            JCSG 371241 PDB Deposition 07-NOV-09              PDB id: 3bbj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_290423.1
DESCRIPTIONThe putative thioesterase II is homologous to thioesterase II from E. coli (1c8u) [Thioesterase/thiol ester dehydrase-isomerase]
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT; Q47MC2_THEFY
DR SPTR;
DR GenBank; YP_290423
DR Pfam; PF03061; 4HBT;
DR PDB; 3BBJ; Identical; 20-NOV-07; PUTATIVE THIOESTERASE II;
DR FFAS; 371241; Fold and function assignment.
DR TVPC; YP_290423.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_290423.1; Ortholog view popup.
DR TPM; YP_290423.1; Target PDB monitor.
DR FSS; YP_290423.1; Target function coverage.
PROPERTY Residues: 271 aa
Molecule Weight: 29733.94 Dalton
Isoelectric Point: 5.75
Extinction Coefficient: 37930
Gravy Index: -.2
Number of Met residues: 4
Percentage of Met residues: 1.48 %
Number of Cys residues: 3
Percentage of Cys residues: 1.11 %
SEQUENCE  amino acids 271 aa
>YP_290423.1  gi|72162766|ref|YP_290423.1| hypothetical protein Tfu_2367 [Thermobifida fusca YX]
MVPMTRFDSATEVVRVGENRYAVELDPGYLIGTAMNGGYLMTVLQRSALAESDHLHAVSS
SYHFHRPASSGPAEIETRVLKRGRTVTTVQTTLFQEGRTILTGTLATATLDPHAEPRYAA
PQPAIPPQHQCRRVDPRQSHLPDDGFLARVDVDFSPDSYAALARERTVTTPELCGYVDLS
ARDGGSAKDPLAFLPLAVDALPPIVSLLVDWSWAPTVELTWHLRAIPEPGPLAFRSTCAL
VSDGWFDENVDLWDARGRLVAQSRQLARVGR

CDS  cDNA 816 bp
   1 atggtcccca tgacccgctt cgactccgcg accgaggtcg ttcgcgtcgg tgagaatcga    60
  61 tatgccgtcg aactcgatcc cggatacctc atcgggaccg caatgaacgg cggctacctc   120
 121 atgacggtgc tgcaacggtc cgcactcgcc gaatccgacc acctgcacgc ggtctcctcc   180
 181 tcttaccact ttcaccgtcc cgctagcagt ggaccggccg agatcgagac ccgggtgctc   240
 241 aaacgcgggc ggaccgtcac caccgtccag accaccctct tccaagaagg gcggacgatc   300
 301 ctcaccggca cgctcgccac tgccacgctc gatccgcacg ccgaaccacg ctacgcagcc   360
 361 cctcagcccg ctatccctcc ccagcaccag tgccgaagag tcgacccccg gcagagccac   420
 421 ctgcctgacg acggattcct cgcccgggtc gacgtggact tcagcccgga cagctacgcg   480
 481 gcactcgcgc gggaacgtac cgtaaccacc cctgaactgt gcggatatgt cgacctgagt   540
 541 gcacgggacg gcggctccgc gaaagacccg ctggcattcc tcccgctcgc cgtggacgcg   600
 601 ctgccgccca tcgtcagtct cctggtggac tggagctggg cgcccaccgt cgaactcacc   660
 661 tggcacctgc gtgcaatccc cgaaccgggg ccgctggcct tccgctccac ctgcgccctg   720
 721 gtcagcgacg gctggttcga tgagaacgtc gacctatggg atgccagggg acgccttgtt   780
 781 gcacagagcc gccaattagc ccgggtcggc cgctga   816
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2790173 2790988 -2 Glimmer3 score 8.51 poor
Genemark probabilities .75   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu