LOADING...
   YP_290167.1;PC04686E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_290167.1    PC04686E            JCSG 361176 PDB Deposition 08-MAR-20              PDB id: 3cm1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_290167.1
DESCRIPTIONSsgA-like sporulation-specific cell division [alpha+beta class]
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT; Q47N25_THEFY
DR SPTR;
DR GenBank; YP_290167
DR Pfam; PF04686; SsgA;
DR PDB; 3CM1; Identical; 01-APR-08; SSGA-LIKE SPORULATION-SPECIFIC CELL DIVISION PROT CHAIN: A,;
DR FFAS; 361176; Fold and function assignment.
DR TVPC; YP_290167.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_290167.1; Ortholog view popup.
DR TPM; YP_290167.1; Target PDB monitor.
DR FSS; YP_290167.1; Target function coverage.
PROPERTY Residues: 138 aa
Molecule Weight: 15250.26 Dalton
Isoelectric Point: 4.46
Extinction Coefficient: 16960
Gravy Index: -.08
Number of Met residues: 2
Percentage of Met residues: 1.45 %
Number of Cys residues: 1
Percentage of Cys residues: 0.72 %
SEQUENCE  amino acids 138 aa
>YP_290167.1  gi|72162510|ref|YP_290167.1| putative regulator [Thermobifida fusca YX]
MSSSGTSITCEVGLQLIVPDRAPVPLVARLDYSVDDPYAIRAAFHVGDDEPVEWIFAREL
LTVGIIRETGEGDVRIWPSQDGKERMVNIALSSPFGQARFHAQVAPLSEFLHRTYELVPA
GQESDYIDIDAEIAEHLS

CDS  cDNA 417 bp
   1 atgagcagca gcggcacctc tatcacctgc gaagtcggtt tgcagctgat cgttcctgat    60
  61 cgtgcccccg tgcccctggt ggcccgtctc gactactccg tggacgaccc ttacgccatc   120
 121 cgggcggcct tccatgtggg cgacgacgaa cccgtggagt ggatcttcgc tcgtgagctg   180
 181 ctgaccgtgg gcatcatccg cgaaacaggc gaaggcgacg tgcgcatctg gccctcgcag   240
 241 gacgggaagg agcgcatggt caacattgcc ctctcctcac ctttcggcca ggcgcggttc   300
 301 cacgcgcagg tggcacccct ctcggagttc ctgcaccgca cctacgagct ggttcctgcc   360
 361 gggcaggaga gcgactacat cgacatcgac gctgaaatcg ctgagcacct cagctag   417
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2471763 2472179 3 Glimmer3 score 9.57 poor
Genemark probabilities .88   .74 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu