LOADING...
   YP_288824.1;FM11991A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_288824.1    FM11991A            JCSG 378307 PDB Deposition 07-NOV-27              PDB id: 3bgu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_288824.1
DESCRIPTIONDimeric ferredoxin-like protein of unknown function [ferredoxin-like]
ORGANISMThermobifida fusca yx-er1
COMMENT 
DR UNIPROT; Q47RW6_THEFY
DR SPTR; Q47RW6 (flat text); Q47RW6 (good view)
DR GenBank; YP_288824
DR Pfam; PF07876; Dabb;
DR PDB; 3BGU; Identical; 11-DEC-07; FERREDOXIN-LIKE PROTEIN OF UNKNOWN FUNCTION;
DR FFAS; 378307; Fold and function assignment.
DR TVPC; YP_288824.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_288824.1; Ortholog view popup.
DR TPM; YP_288824.1; Target PDB monitor.
DR FSS; YP_288824.1; Target function coverage.
PROPERTY Residues: 97 aa
Molecule Weight: 10535.37 Dalton
Isoelectric Point: 4.67
Extinction Coefficient: 9970
Gravy Index: .17
Number of Met residues: 2
Percentage of Met residues: 2.06 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 97 aa
>YP_288824.1  gi|72161167|ref|YP_288824.1| hypothetical protein Tfu_0763 [Thermobifida fusca YX]
MGIRHIALFRWNDTVTPDQVEQVITALSKLPAAIPELKNYAFGADLGLAAGNYDFAVVAD
LDGEDGFRAYQDHPDHRAALAIIAPMLADRVAVQFAL

CDS  cDNA 294 bp
   1 atgggaattc ggcatatcgc actgttccgc tggaacgaca ctgtcacccc tgaccaggtc    60
  61 gagcaggtca taacggccct gagcaagctg cccgcggcaa tcccggagct gaaaaactac   120
 121 gccttcggtg cagacctcgg gcttgcagca gggaactacg acttcgcagt cgtcgccgac   180
 181 ctcgacgggg aagacggctt ccgggcctac caggaccatc ctgaccaccg ggcggcgctg   240
 241 gcgatcatcg ctccgatgct ggcagaccgc gtcgcggtgc agttcgccct ctga   294
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
905226 905519 3 Glimmer3 score 8.14 poor
Genemark probabilities .76   .22 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu