LOADING...
   YP_265084.1;TT16490A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_265084.1    TT16490A            JCSG 406062 PDB Deposition 10-OCT-27              PDB id: 3pf0

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_265084.1
DESCRIPTIONImelysin-like protein
ORGANISMPsychrobacter arcticum 273-4
COMMENTThis protein belongs to the PFAM Peptidase_M75 family (PF09375) of
proteins. Merops characterizes this family by a HXXE motif which is present in
two M75 metallopeptidases previously determined by the JCSG (PDB accession
codes 3oyv and 3n8u, 100% sequence identity - these were the first structures
of the M75 family). However, this protein lacks such a motif. Merops family
M75 contains only a single protein where this motif is not conserved,
YP_003268262.1, annotated as imelysin. Instead of the conserved histidine, a
proline residue is found. The same occurs for this protein, where in the
TopMatch protein structure alignment (274 equivalent residues, 1.8A rmsd, 15%
seq. identity, ONE permutation!) the conserved
His-368,Thr,Leu,Glu-371 is aligned to
Pro-194,Gly,Leu,Glu-197.

Furthermore, this model of the protein structure does not include metal ions,
either. A Blast search in Merops with this protein's sequence does not reveal
any significant hits. They all come up with an E-value greater than 0.001.
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF09375; Peptidase_M75;
DR PDB; 3PF0; Identical; 10-NOV-10; IMELYSIN-LIKE PROTEIN;
DR FFAS; 404834; Fold and function assignment.
DR TVPC; YP_265084.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_265084.1; Ortholog view popup.
DR TPM; YP_265084.1; Target PDB monitor.
DR FSS; YP_265084.1; Target function coverage.
PROPERTY Residues: 389 aa
Molecule Weight: 41119.79 Dalton
Isoelectric Point: 4.66
Extinction Coefficient: 33920
Gravy Index: -.13
Number of Met residues: 9
Percentage of Met residues: 2.31 %
Number of Cys residues: 3
Percentage of Cys residues: 0.77 %
SEQUENCE  amino acids 389 aa
>YP_265084.1  gi|71066357|ref|YP_265084.1| hypothetical protein Psyc_1802 [Psychrobacter arcticus 273-4]
MKINHVLAMALSALSAGILISCVKPADDNNAAEVDRQVAQDSAEPKTGENAAAGDSSSTN
KNAEKIVAVDISAETEKTYLTHVANDMVIPAYADAAKQSDLLHDLAQKHCQKAPVSGDEL
QALRDQWLVLAQAWASAEMVNFGPATASMSNLYINYYPDERGLVHGGVADLITANPALTA
EQLANESAVVQGIPGLEEALYANDSLDAGQCAYVMSASSALGTRLKDIEKNWQQNAIKLL
AIDKTAESDQGLNQWFNSLLSLVETMKSNAIEQPLGLSGKAKGHLPAATAGQSRAIINAK
LATLNKAMTDPVLTAILGSNNENTVADTLSTALADTTALLAQMPEDLATADKATQQELYD
HLTNITRLIKSQLIPTLGIRVGFNSTDGD

CDS  cDNA 1170 bp
   1 atgaaaataa accatgtgtt agcaatggca ctgtcggcat taagtgcggg aatactcatt    60
  61 agttgcgtca aacctgctga tgacaataac gcagcagagg tagacagaca agttgcacag   120
 121 gacagtgctg agcctaaaac tggcgaaaat gctgcggctg gtgatagcag cagtacgaat   180
 181 aaaaatgctg aaaaaatagt cgctgttgat atcagtgctg agacagaaaa aacctattta   240
 241 acccatgtgg ctaatgatat ggtcattcca gcatatgctg atgcggcgaa acaaagtgat   300
 301 ttattgcatg atttggcaca aaagcattgt caaaaagcgc cagtcagcgg tgatgaatta   360
 361 caagcactgc gtgatcagtg gctggtatta gcacaagcat gggcaagtgc tgagatggtt   420
 421 aacttcggtc ctgcgactgc cagtatgagc aatctatata tcaactatta tcctgatgag   480
 481 cgcggtttgg tacatggcgg cgtcgctgat cttatcactg ccaatccagc actgacggct   540
 541 gagcaacttg ctaatgaaag cgccgttgtc caaggcatcc ccggtctaga ggaagcactc   600
 601 tatgctaatg acagcttgga cgccggtcag tgtgcttatg ttatgagtgc cagtagtgcg   660
 661 ctgggtacac gtctaaagga tattgagaaa aactggcagc aaaacgccat taagctgttg   720
 721 gctattgata aaaccgccga aagcgatcaa ggcttgaacc aatggtttaa ctctctgctt   780
 781 tcattggtag agacgatgaa gtctaacgcc attgagcagc cattaggctt gagcggtaaa   840
 841 gccaaaggtc atctacctgc tgcgactgca gggcaaagtc gcgcgattat caatgcaaaa   900
 901 ttagcgacct taaataaagc catgaccgat ccggtattga ctgctatctt gggcagcaat   960
 961 aatgaaaata ccgtagcaga tacgctatca accgcccttg ctgataccac ggcgctattg  1020
1021 gcacaaatgc cagaagattt ggctactgct gataaagcca cgcagcaaga gctgtatgat  1080
1081 catctcacca acatcacgcg cttgattaaa agccaattga ttccaacgct cggtatccgt  1140
1141 gtgggtttta atagtaccga tggcgattaa  1170
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2213195 2214364 -2 Glimmer3 score 13.94 good
Genemark probabilities .9   .45 good
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu