LOADING...
   YP_213754.1;SP3088D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_213754.1    SP3088D            JCSG 418282 PDB Deposition 14-JAN-16              PDB id: 4ogz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_213754.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides fragilis nctc 9343
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF10632; He_PIG_assoc;
DR Pfam; PF05345; He_PIG;
DR PDB; 4OGZ; Identical; 05-FEB-14; PUTATIVE ALPHA-GALACTOSIDASE/MELIBIASE;
DR PDB; 4NZJ; Highly similar; 25-DEC-13; PUTATIVE ALPHA-GALACTOSIDASE;
DR PDB; 1UAS; Highly similar; 01-JUL-03; ALPHA-GALACTOSIDASE;
DR PDB; 3A5V; Highly similar; 25-AUG-09; ALPHA-GALACTOSIDASE;
DR PDB; 1R46; Highly similar; 16-MAR-04; ALPHA-GALACTOSIDASE A;
DR PDB; 1R47; Highly similar; 16-MAR-04; ALPHA-GALACTOSIDASE A;
DR PDB; 3GXN; Highly similar; 05-MAY-09; ALPHA-GALACTOSIDASE A;
DR PDB; 3GXP; Highly similar; 05-MAY-09; ALPHA-GALACTOSIDASE A;
DR FFAS; 407687; Fold and function assignment.
DR TVPC; YP_213754.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_213754.1; Ortholog view popup.
DR TPM; YP_213754.1; Target PDB monitor.
DR FSS; YP_213754.1; Target function coverage.
PROPERTY Residues: 496 aa
Molecule Weight: 55193.23 Dalton
Isoelectric Point: 5.4
Extinction Coefficient: 106800
Gravy Index: -.22
Number of Met residues: 12
Percentage of Met residues: 2.42 %
Number of Cys residues: 13
Percentage of Cys residues: 2.62 %
SEQUENCE  amino acids 496 aa
>YP_213754.1  gi|60683610|ref|YP_213754.1| putative alpha-galactosidase/melibiase [Bacteroides fragilis NCTC 9343]
MKITSYVSFLYCLCLMLASPTVQASEVRTAIFEGKPCINPPHVVGNYPATPFLFYIPTSG
ERPIKWHAENLPKGLKLDKETGIIKGKVVEKGTYKVMLKAENALGTDTQELLINIGDELL
LTPPMGWNSWNTFGRHLTEELLLQTADAMVENGMRDLGYAYINIDDFWQLPERGADGHIQ
IDKTKFPRGIKYVADYLHERGFKLGIYSDAADKTCGGVCGSYGYEEIDARDFASWGVDLL
KYDYCNAPAGRVEAMERYEKMGRALRATDRSIVFSICEWGQREPWKWAKKVGGHLWRVSG
DIGDLWNRSTDEKGGLRGILNILEINAPLSEYARPGGWNDPDMLVVGIGGKSKSIGYESE
GCTNEQYQSHFALWCMMASPLLCGNDVRQMNDSTLQILLNKDLIAINQDPLGIQAERAIR
ADHYDVWVKPLSDGSKAIACLNRISGPVDVELNVKTVEGLSLDRVYDVIEGSLVAEASTG
WVVKLAPGECKVFICK

CDS  cDNA 1491 bp
   1 atgaaaatta caagttatgt ttctttttta tattgcttat gtctgatgct ggcgagtccg    60
  61 acagtacagg cgagcgaagt gcgaaccgct atttttgagg ggaaaccgtg tattaatccc   120
 121 cctcatgtgg tgggaaacta tcctgctacc ccttttttgt tttatattcc cacctccgga   180
 181 gaacgaccga taaagtggca tgctgaaaat cttcccaagg gattgaagct ggataaagaa   240
 241 acggggataa tcaagggaaa agtagtagaa aagggaacgt acaaagtaat gctgaaagct   300
 301 gagaatgccc ttggaaccga tacacaggaa ctactgatta atataggaga tgagttgttg   360
 361 ctgactcctc cgatggggtg gaacagttgg aatacattcg gacgtcacct gacagaggag   420
 421 ctactgttgc aaactgcaga tgcaatggta gaaaacggaa tgcgtgattt ggggtatgct   480
 481 tatattaata tcgatgactt ttggcagttg cctgaaaggg gagctgacgg tcatatccaa   540
 541 attgataaaa caaagttccc gagaggcatc aaatatgtgg ccgattactt gcatgagcga   600
 601 ggattcaaac ttggaattta ttcggatgcc gctgataaaa cttgtggtgg ggtttgtggc   660
 661 agttatggat atgaagaaat tgatgcacgg gatttcgcat cctggggtgt tgatcttttg   720
 721 aagtatgact attgcaatgc acctgccgga agagtagaag cgatggaaag atatgagaag   780
 781 atggggaggg cattgagagc gaccgaccgt tctatcgtct tttcaatttg tgagtgggga   840
 841 cagcgtgaac cttggaaatg ggcgaagaaa gtcggcggac atttatggcg agtatccggt   900
 901 gatattggcg acttgtggaa tcgttcgaca gacgaaaagg gaggtttacg tggcattttg   960
 961 aacattcttg aaataaatgc accgcttagt gaatatgcaa gacccggcgg atggaatgat  1020
1021 ccggatatgc ttgttgtggg gattggcgga aaaagtaaga gtatcggtta tgaatcggaa  1080
1081 ggttgtacga atgaacaata tcagtcccac tttgctctct ggtgcatgat ggcttctcca  1140
1141 ttactctgtg gcaatgatgt acggcagatg aatgatagta cgttacaaat acttttgaat  1200
1201 aaggatctga ttgctatcaa tcaggatccg ctgggcattc aggcagagcg tgccattcgt  1260
1261 gccgatcatt atgatgtctg ggtgaagccg ttgagtgacg gaagcaaagc aatagcttgt  1320
1321 ctgaaccgga tatccggacc cgtagacgtg gagttgaatg taaagacggt agaaggattg  1380
1381 tcattggatc gggtatatga tgttatagaa ggcagccttg tggctgaggc ttctaccgga  1440
1441 tgggtcgtaa agcttgctcc cggtgagtgt aaagtgttta tatgtaaata a  1491
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu