LOADING...
   YP_213353.1;TT4069B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_213353.1    TT4069B            JCSG 419039 PDB Deposition 14-FEB-27              PDB id: 4ppy

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_213353.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides fragilis nctc 9343
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00657; Lipase_GDSL;
DR PDB; 4PPY; Identical; 02-APR-14; PUTATIVE ACYLHYDROLASE;
DR PDB; 4HF7; Highly similar; 24-OCT-12; PUTATIVE ACYLHYDROLASE;
DR PDB; 4IYJ; Highly similar; 06-MAR-13; GDSL-LIKE PROTEIN;
DR PDB; 3P94; Highly similar; 03-NOV-10; GDSL-LIKE LIPASE;
DR FFAS; 404781; Fold and function assignment.
DR TVPC; YP_213353.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_213353.1; Ortholog view popup.
DR TPM; YP_213353.1; Target PDB monitor.
DR FSS; YP_213353.1; Target function coverage.
PROPERTY Residues: 235 aa
Molecule Weight: 26165.54 Dalton
Isoelectric Point: 9.2
Extinction Coefficient: 35410
Gravy Index: -.28
Number of Met residues: 7
Percentage of Met residues: 2.98 %
Number of Cys residues: 1
Percentage of Cys residues: 0.43 %
SEQUENCE  amino acids 235 aa
>YP_213353.1  gi|60683209|ref|YP_213353.1| putative acylhydrolase [Bacteroides fragilis NCTC 9343]
MKKQIIHRWMLMAVFCLGASLIGINAQEKDWANLQRYAQQNAELPKPDKNEKRVVFMGNS
ITEGWVNTHPDFFKSNGYIGRGIGGQTSYQFLVRFREDVINLSPALVVINAATNDIAENT
GAYHEDRTFGNIVSMVELAKANHIKVILTTTLPAAAFGWNPSIKDAPQKIASLNARLKAY
AQTNKIPFVDYYSSMVSGSNKALNPAYTKDGVHPTSEGYDVMENLIQQAINKTLR

CDS  cDNA 708 bp
   1 atgaaaaagc aaatcataca ccgctggatg ctgatggctg tcttctgcct cggagcatca    60
  61 ttgataggaa taaatgccca agaaaaagac tgggctaacc tgcaacgtta tgcacaacaa   120
 121 aacgccgaac ttccgaaacc ggacaaaaac gaaaagagag tggtctttat gggcaattcc   180
 181 atcacagaag gatgggtaaa cactcatcct gatttcttta aatccaacgg ttacatcggc   240
 241 cggggcatcg gcggacagac ttcttaccag ttcctggtac gtttcaggga agatgtcatc   300
 301 aacttatctc ctgcactggt agtaatcaat gcagccacaa atgatattgc cgagaacaca   360
 361 ggagcatatc atgaggaccg cacttttggc aatattgttt cgatggtgga actggcaaaa   420
 421 gccaatcata taaaagtgat attgaccacc actttaccgg ctgccgcttt cggttggaat   480
 481 ccttccatta aagatgctcc tcaaaagata gcttcactca atgcacgtct gaaagcctat   540
 541 gcccaaacaa ataaaattcc attcgtcgac tattactctt ctatggtgag cggtagcaac   600
 601 aaagctttga atccggccta taccaaagat ggtgtgcatc ccacttccga aggatatgac   660
 661 gttatggaga atctcattca acaggctata aacaagactt tacgataa   708
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu