LOADING...
   YP_211072.1;SP3088C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_211072.1    SP3088C            JCSG 419777 PDB Deposition 13-DEC-12              PDB id: 4nzj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_211072.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides fragilis nctc 9343
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF10632; He_PIG_assoc;
DR Pfam; PF05345; He_PIG;
DR PDB; 4NZJ; Identical; 25-DEC-13; PUTATIVE ALPHA-GALACTOSIDASE;
DR PDB; 4OGZ; Highly similar; 05-FEB-14; PUTATIVE ALPHA-GALACTOSIDASE/MELIBIASE;
DR PDB; 1UAS; Highly similar; 01-JUL-03; ALPHA-GALACTOSIDASE;
DR PDB; 3A5V; Highly similar; 25-AUG-09; ALPHA-GALACTOSIDASE;
DR PDB; 1R46; Highly similar; 16-MAR-04; ALPHA-GALACTOSIDASE A;
DR PDB; 1R47; Highly similar; 16-MAR-04; ALPHA-GALACTOSIDASE A;
DR PDB; 3GXN; Highly similar; 05-MAY-09; ALPHA-GALACTOSIDASE A;
DR PDB; 3GXP; Highly similar; 05-MAY-09; ALPHA-GALACTOSIDASE A;
DR FFAS; 407686; Fold and function assignment.
DR TVPC; YP_211072.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_211072.1; Ortholog view popup.
DR TPM; YP_211072.1; Target PDB monitor.
DR FSS; YP_211072.1; Target function coverage.
PROPERTY Residues: 500 aa
Molecule Weight: 55956.74 Dalton
Isoelectric Point: 5.43
Extinction Coefficient: 111270
Gravy Index: -.24
Number of Met residues: 13
Percentage of Met residues: 2.60 %
Number of Cys residues: 9
Percentage of Cys residues: 1.80 %
SEQUENCE  amino acids 500 aa
>YP_211072.1  gi|60680928|ref|YP_211072.1| putative alpha-galactosidase [Bacteroides fragilis NCTC 9343]
MNKPYFIAFLLFLALWTAIPSVFAGDVVLKVFEGKPRINSPHIIGNYPSTPFIFYIPTSG
QRPMQWSAEKLPEGLELDSKTGIISGVMTSKGDYTVTLKAENALGVSVKQLVIRIGDELL
LTPPMGWNSWNTFGQHLTEELVLQTADAMITNGMRDLGYSYINIDDFWQLPERGADGHLQ
IDKTKFPRGIKYVADYLHERGFKLGIYSDAAEKTCGGVCGSYGYEETDAKDFASWGVDLL
KYDYCNAPVDRVEAMERYAKMGRALRATNRSIVYSVCEWGQREPWKWAKQVGGHLWRVSG
DIGDIWYRDGNRVGGLHGILNILEINAPLSEYAGPSGWNDPDMLVVGIDGKSMSIGYESE
GCTQEQYKSHFSLWCMMASPLLSGNDVRNMNDSTLKILLDPDLIAINQDVLGRQAERSIR
SDHYDIWVKPLADGRKAVACFNRASSPQTVILNENTIADLSFEQIYCLDNHLTKSGSDSK
ELIVKLAPYQCKVYIFGKTD

CDS  cDNA 1503 bp
   1 atgaacaaac cctatttcat tgcattttta ctctttttag ctttatggac agccattcct    60
  61 tctgtttttg ccggagatgt tgttttaaaa gtatttgaag ggaaaccacg tatcaattct   120
 121 cctcatatca taggtaatta tccttcaact ccatttatct tttatattcc gacttccggt   180
 181 cagcgaccga tgcagtggag tgcggaaaaa ctccccgaag gactggaact ggattccaag   240
 241 actggcatta ttagtggagt catgacttcc aaaggagatt ataccgtaac cctgaaggct   300
 301 gagaatgcat taggtgtaag tgtgaaacaa ttggtcatcc gcattggtga tgaattatta   360
 361 ttaactcctc caatgggctg gaacagttgg aatactttcg gacagcatct gacagaagaa   420
 421 ttggtcttgc aaacggcgga tgcgatgata acgaacggaa tgcgtgattt aggatattcc   480
 481 tatatcaata tagatgactt ttggcagttg ccggaacggg gggctgacgg acatctgcag   540
 541 attgataaaa ctaagtttcc acgtgggata aaatatgtag ctgattatct gcacgagcgt   600
 601 gggtttaaat tgggaattta ttcggatgcc gccgaaaaaa cttgtggcgg cgtttgcggt   660
 661 agctacggat atgaagaaac agatgcaaaa gattttgcct cttggggagt tgacttgttg   720
 721 aaatatgact attgcaatgc tcctgtagat agggtagaag ccatggagcg atatgcgaaa   780
 781 atgggaaggg cactacgggc taccaatcgt tcgattgtct attcagtgtg tgagtgggga   840
 841 cagcgtgaac cttggaaatg ggcgaagcaa gtggggggac atttatggag agtatcagga   900
 901 gatatcggtg acatttggta tcgggatgga aatcgtgttg gtggattaca tggtatattg   960
 961 aatatccttg aaatcaatgc tcctctgagt gaatatgccg gtccatccgg ttggaatgat  1020
1021 ccggatatgt tagtggtcgg aatagatgga aagagtatga gtattggtta tgagtcggaa  1080
1081 ggatgtactc aggaacaata taaatcccat tttagcctgt ggtgtatgat ggcttctcct  1140
1141 ttactttccg gaaacgatgt acggaatatg aatgatagta cattaaaaat cttgttggat  1200
1201 cctgatttaa tagccattaa tcaggatgtg ttaggtaggc aggcagaacg cagcattcgt  1260
1261 tcggatcatt atgatatttg ggtaaagccg ttggcagatg gacgtaaagc tgtggcttgc  1320
1321 tttaaccggg caagctctcc gcaaactgtg atattgaatg aaaatacgat tgccgattta  1380
1381 tcattcgagc agatatactg tttggacaac catttgacaa agagtggtag tgattcaaag  1440
1441 gaactgatag taaaactggc cccatatcaa tgtaaggtct atattttcgg taaaacggat  1500
1501 tga  1503
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu