LOADING...
   YP_209798.1;GS13256M
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_209798.1    GS13256M            JCSG 386541 PDB Deposition 14-SEP-09              PDB id: 4raa

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_209798.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides fragilis nctc 9343
COMMENT 
DR UNIPROT; Q5LJ40_BACFN
DR SPTR; Q5LJ40 (flat text); Q5LJ40 (good view)
DR GenBank; YP_209798
DR PDB; 4RAA; Identical; 15-OCT-14; PUTATIVE EXPORTED PROTEIN;
DR FFAS; 385139; Fold and function assignment.
DR TVPC; YP_209798.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_209798.1; Ortholog view popup.
DR TPM; YP_209798.1; Target PDB monitor.
DR FSS; YP_209798.1; Target function coverage.
PROPERTY Residues: 383 aa
Molecule Weight: 43799.29 Dalton
Isoelectric Point: 4.77
Extinction Coefficient: 49740
Gravy Index: -.15
Number of Met residues: 5
Percentage of Met residues: 1.31 %
Number of Cys residues: 8
Percentage of Cys residues: 2.09 %
SEQUENCE  amino acids 383 aa
>YP_209798.1  gi|60679654|ref|YP_209798.1| hypothetical protein BF0058 [Bacteroides fragilis NCTC 9343]
MVTKWKITVGLLLILFCGCSQVKELHESSTIISFKEHTDVNADSILELSFLKLQTKDSCL
VKNVGLIRELNNCLLILDSANSNLYVFNKSGAFVNQIGQKGSGPGEYILLSSFFVDNNKN
YIAAIDIAQDKVLYYNATDFSFLYERRLPFSTSCCLQLEDGNLLWNSREYTDSKLSDFYF
VVTDSLFDIIDYKMNKEFKSGYTTGPSQMIYKVGTNVFAYTPFDLTIYRVGTSEIVPAHS
FSFEGTDIPSLDFLNKTSNQGNSNYLYDLIQSDYISYYCVEETERDLFVCYMKNKEKYIG
LYDKNTDRTYNYPIKIFQDQLKVGELNYFSIGSVDDYHVAPLDVLSLKDMAGNGYVFDDK
LSELLTISNEEDNSILLFVRIKK

CDS  cDNA 1152 bp
   1 atggtgacaa agtggaaaat tacagttggg ctactactta tactattttg tggttgtagc    60
  61 caagtgaaag aattgcatga aagcagtaca attatttctt ttaaagaaca tactgatgta   120
 121 aatgcggata gtatattaga gttatctttc ttaaagcttc aaacaaaaga ttcatgtttg   180
 181 gtaaagaatg ttgggcttat tagagaatta aataattgtt tattaatatt ggattctgcc   240
 241 aactctaatt tgtatgtttt taacaaatca ggagcttttg taaatcagat aggacagaag   300
 301 ggaagtggcc ccggtgaata tatattgtta tcttcatttt ttgtagacaa taataaaaat   360
 361 tatattgccg caattgatat tgcccaagat aaagtattgt attacaatgc gactgatttt   420
 421 agttttttgt acgaaaggag attacctttt agtacatctt gctgtttaca gttagaggat   480
 481 ggtaatttgc tttggaatag tagagaatat acagactcta aattatctga cttctatttt   540
 541 gtggttacag attctttgtt tgatattata gattataaaa tgaataaaga gtttaaatct   600
 601 ggttatacaa cagggccttc tcaaatgata tataaggttg gaaccaatgt atttgcatat   660
 661 actccttttg atttgacgat ttatagagtg ggtacttctg agatagttcc tgctcattct   720
 721 ttttcatttg agggtactga tatcccttct ttagattttc tgaataaaac tagtaatcag   780
 781 ggaaactcta attacttata tgatctgatt caatccgatt atatttctta ttattgtgta   840
 841 gaagaaactg aacgtgattt gtttgtatgc tatatgaaaa ataaagaaaa gtatataggg   900
 901 ttgtatgata agaatactga tagaacgtat aattatccaa ttaaaatatt tcaggatcag   960
 961 ttaaaggtcg gtgaactgaa ttattttagt ataggttcag ttgatgatta tcatgtggct  1020
1021 ccattggatg tattatcctt aaaagatatg gcaggaaatg gatatgtgtt tgatgataag  1080
1081 ttgtctgaat tgctaacaat atcgaacgaa gaggataatt ctatattatt atttgttcgg  1140
1141 attaaaaaat ag  1152
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu