LOADING...
   YP_193882.1;GD9765C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_193882.1    GD9765C            JCSG 388454 PDB Deposition 15-APR-08              PDB id: 3edo, 2n1m

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_193882.1
DESCRIPTIONgi|58337297|ref|YP_193882.1| putative trp repressor binding protein [Lactobacill
us acidophilus NCFM]
ORGANISMLactobacillus acidophilus NCFM
COMMENT 
DR UNIPROT; Q5FKC3_LACAC
DR SPTR; Q5FKC3 (flat text); Q5FKC3 (good view)
DR GenBank; YP_193882
DR PDB; 3EDO; Identical; 30-SEP-08; PUTATIVE TRP REPRESSOR BINDING PROTEIN;
DR PDB; 2MWM; Identical; 10-DEC-14; PUTATIVE TRP REPRESSOR BINDING PROTEIN;
DR PDB; 2N1M; Identical; 22-APR-15; PUTATIVE TRP REPRESSOR BINDING PROTEIN;
DR FFAS; 388454; Fold and function assignment.
DR TVPC; YP_193882.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_193882.1; Ortholog view popup.
DR TPM; YP_193882.1; Target PDB monitor.
DR FSS; YP_193882.1; Target function coverage.
PROPERTY Residues: 150 aa
Molecule Weight: 17002.15 Dalton
Isoelectric Point: 4.81
Extinction Coefficient: 33920
Gravy Index: -.55
Number of Met residues: 4
Percentage of Met residues: 2.67 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 150 aa
>YP_193882.1  gi|58337297|ref|YP_193882.1| putative trp repressor binding protein [Lactobacillus acidophilus NCFM]
MAKKTLILYYSWSGETKKMAEKINSEIKDSELKEVKVSEGTFDADMYKTSDIALDQIQGN
KDFPEIQLDNIDYNNYDLILIGSPVWSGYPATPIKTLLDQMKNYRGEVASFFTSAGTNHK
AYVSHFNEWADGLNVIGVARDDSEVDKWSK

CDS  cDNA 453 bp
   1 atggctaaaa aaacattaat tttatattat tcttggtctg gtgaaaccaa gaaaatggcg    60
  61 gaaaagatca atagtgaaat taaagatagc gagctcaaag aagtaaaagt atctgaagga   120
 121 acttttgatg ctgatatgta taagacttca gatatcgcat tagatcaaat tcaaggaaat   180
 181 aaggattttc cagaaatcca attagataat atagattata ataattatga tttaatctta   240
 241 attggtagtc cagtttggtc aggctatcct gcaactccaa tcaaaacttt acttgatcaa   300
 301 atgaagaatt atagaggcga agttgcatca ttctttactt cagctggaac aaatcataaa   360
 361 gcatatgtta gtcactttaa tgaatgggca gatggtttga atgttattgg tgtggctaga   420
 421 gatgatagtg aagttgataa atggagtaaa taa   453
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu