|
YP_111841.1;PU10172A |
Protein Sequence Comparative Analysis (PSCA) | |
|
YP_111841.1 PU10172A JCSG 381695 PDB Deposition 08-DEC-15 PDB id: 3fjv Protein Sequence Information
SEQUENCE amino acids 193 aa >YP_111841.1 gi|53722856|ref|YP_111841.1| hypothetical protein BPSS1837 [Burkholderia pseudomallei K96243] MTLTRDSLLTLEAYAKVRRQEHARVIAHKKRRAVSIGNHLRLLFEDETTIRYQIHEMLHI EKIFDEDGIQAELDAYLPLVPDGSNLKATLQIEYENETQRRAALARLVGIEDRVFLRVDD EAPVYAIADEDLERDTAEKTSAVHFLRFELGDAMKAKLKAGAPLSIGCDHPHYPIQAARI DPDVAASLAGDLD CDS cDNA 582 bp 1 atgacgctta cccgcgattc gctgttgacg ctcgaagcgt acgcgaaagt acgccgccag 60 61 gagcatgcgc gcgtgatcgc gcacaaaaag cgccgcgccg tgtcgatcgg caatcatctg 120 121 cgcctgctgt tcgaggacga gacgacgatt cgctatcaga tccacgaaat gctgcacatc 180 181 gagaaaatat tcgacgagga cggcatccag gccgagctcg acgcgtacct gccgctcgtg 240 241 ccggacggca gcaatctgaa ggcaacgctg cagatcgaat acgaaaacga aacgcagcgg 300 301 cgcgcggcgc tcgcgcgcct cgtcggcatc gaggaccggg tatttctgcg ggtggacgat 360 361 gaggcgcctg tctacgcgat cgccgacgag gacctcgagc gcgacaccgc cgagaagacg 420 421 tcggccgtgc acttcctgcg cttcgaactc ggcgacgcga tgaaggcgaa gctcaaggcg 480 481 ggcgcgccgc tgtcgatcgg ctgcgaccat cctcactatc cgatacaagc ggcgaggatc 540 541 gatccggacg tggccgcctc tctggccggc gatctcgact ga 582Target constructs Download sequence in PIR or FASTA format Chemical properties of sequence with tag
Notes The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951). Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function. |