LOADING...
   YP_111841.1;PU10172A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_111841.1    PU10172A            JCSG 381695 PDB Deposition 08-DEC-15              PDB id: 3fjv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_111841.1
DESCRIPTIONNovel protein of unknown function. It is similar to AAO38360 (GenBank) annotated as being induced under nitrogen fixation.
ORGANISMBurkholderia pseudomallei k96243
COMMENT 
DR UNIPROT; Q63J81_BURPS
DR SPTR; Q63J81 (flat text); Q63J81 (good view)
DR GenBank; YP_111841
DR PDB; 3FJV; Identical; 13-JAN-09; UNCHARACTERIZED NOVEL PROTEIN;
DR FFAS; 381695; Fold and function assignment.
DR TVPC; YP_111841.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_111841.1; Ortholog view popup.
DR TPM; YP_111841.1; Target PDB monitor.
DR FSS; YP_111841.1; Target function coverage.
PROPERTY Residues: 193 aa
Molecule Weight: 21766.45 Dalton
Isoelectric Point: 5.28
Extinction Coefficient: 8940
Gravy Index: -.34
Number of Met residues: 3
Percentage of Met residues: 1.55 %
Number of Cys residues: 1
Percentage of Cys residues: 0.52 %
SEQUENCE  amino acids 193 aa
>YP_111841.1  gi|53722856|ref|YP_111841.1| hypothetical protein BPSS1837 [Burkholderia pseudomallei K96243]
MTLTRDSLLTLEAYAKVRRQEHARVIAHKKRRAVSIGNHLRLLFEDETTIRYQIHEMLHI
EKIFDEDGIQAELDAYLPLVPDGSNLKATLQIEYENETQRRAALARLVGIEDRVFLRVDD
EAPVYAIADEDLERDTAEKTSAVHFLRFELGDAMKAKLKAGAPLSIGCDHPHYPIQAARI
DPDVAASLAGDLD

CDS  cDNA 582 bp
   1 atgacgctta cccgcgattc gctgttgacg ctcgaagcgt acgcgaaagt acgccgccag    60
  61 gagcatgcgc gcgtgatcgc gcacaaaaag cgccgcgccg tgtcgatcgg caatcatctg   120
 121 cgcctgctgt tcgaggacga gacgacgatt cgctatcaga tccacgaaat gctgcacatc   180
 181 gagaaaatat tcgacgagga cggcatccag gccgagctcg acgcgtacct gccgctcgtg   240
 241 ccggacggca gcaatctgaa ggcaacgctg cagatcgaat acgaaaacga aacgcagcgg   300
 301 cgcgcggcgc tcgcgcgcct cgtcggcatc gaggaccggg tatttctgcg ggtggacgat   360
 361 gaggcgcctg tctacgcgat cgccgacgag gacctcgagc gcgacaccgc cgagaagacg   420
 421 tcggccgtgc acttcctgcg cttcgaactc ggcgacgcga tgaaggcgaa gctcaaggcg   480
 481 ggcgcgccgc tgtcgatcgg ctgcgaccat cctcactatc cgatacaagc ggcgaggatc   540
 541 gatccggacg tggccgcctc tctggccggc gatctcgact ga   582
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu