LOADING...
   YP_108686.1;PH10118E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_108686.1    PH10118E            JCSG 373333 PDB Deposition 14-OCT-02              PDB id: 4rho

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_108686.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBurkholderia pseudomallei k96243
COMMENT 
DR UNIPROT; Q63T80_BURPS
DR SPTR;
DR GenBank; YP_108686
DR PDB; 4RHO; Identical; 10-DEC-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 373333; Fold and function assignment.
DR TVPC; YP_108686.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_108686.1; Ortholog view popup.
DR TPM; YP_108686.1; Target PDB monitor.
DR FSS; YP_108686.1; Target function coverage.
PROPERTY Residues: 240 aa
Molecule Weight: 26133.24 Dalton
Isoelectric Point: 5.41
Extinction Coefficient: 23950
Gravy Index: -.17
Number of Met residues: 6
Percentage of Met residues: 2.50 %
Number of Cys residues: 2
Percentage of Cys residues: 0.83 %
SEQUENCE  amino acids 240 aa
>YP_108686.1  gi|53719700|ref|YP_108686.1| hypothetical protein BPSL2088 [Burkholderia pseudomallei K96243]
MEIKAMFRDVSLSSRNFSEMLSRESKVVAALAAKSPLMAHANWRLKGNSLEEATLYPAFD
ADGSPSTPALAVLNEEQRGKKHSASHAAIWNGNTRPNEGASMSCHVSDEKVLPDRFSTRL
GVPDCYAKSQDLADVVTTIVAAFNPLVVEASPEGYFDKQVFDDKPGVGWMLYLPKVITQQ
QVPEARALIPVSAKGKQTGTIIVSVTDAPFSVDNPEHVAIANRIEIRLVDQDLLPAYVDI

CDS  cDNA 723 bp
   1 atggaaatca aagcgatgtt ccgggacgta tcgctgtcgt cccgcaattt ctccgagatg    60
  61 ctgagtcgag agtcgaaagt tgtcgctgcg ctcgcggcga agagcccgct gatggcgcac   120
 121 gcgaattggc gactcaaagg gaattcgctc gaagaagcga cactctaccc ggcatttgat   180
 181 gcagacggct cgccctctac tcctgcattg gcagtcttaa acgaagagca gcgcggcaag   240
 241 aagcatagcg cttcccatgc ggcgatatgg aatggcaata cacgccccaa cgaaggcgca   300
 301 tcgatgtcgt gtcatgtatc agacgaaaag gtcttaccgg accgattttc gacacgtctg   360
 361 ggcgtccccg actgctatgc gaaatcgcaa gatctcgcag acgtcgtcac taccattgtt   420
 421 gccgcgttca atccgcttgt cgtagaagca tcgcccgagg gctacttcga caaacaagta   480
 481 ttcgacgaca agcccggtgt cggctggatg ctctacttgc cgaaggtcat cacgcaacag   540
 541 caggttcccg aggcacgagc gctgattccc gtatccgcca aaggcaaaca gaccggcacg   600
 601 atcatcgtca gcgtcacgga cgccccgttc tcggtcgaca atcccgagca cgtcgcgatc   660
 661 gcgaatcgca tcgagatccg gctcgtcgat caagacttgc tccccgccta cgtcgatatc   720
 721 tga   723
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
Glimmer3 score - -
Genemark probabilities -   - -
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu