LOADING...
   YP_098753.1;SP13297E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_098753.1    SP13297E            JCSG 418300 PDB Deposition 14-FEB-18              PDB id: 4ouq

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_098753.1
DESCRIPTIONDUF4783 family protein, PF16022 family
ORGANISMBacteroides fragilis ych46
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4OUQ; Identical; 30-APR-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4Q53; Highly similar; 16-JUL-14; UNCHARACTERIZED PROTEIN;
DR PDB; 4ORL; Highly similar; 05-MAR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 407827; Fold and function assignment.
DR TVPC; YP_098753.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_098753.1; Ortholog view popup.
DR TPM; YP_098753.1; Target PDB monitor.
DR FSS; YP_098753.1; Target function coverage.
PROPERTY Residues: 130 aa
Molecule Weight: 14646.05 Dalton
Isoelectric Point: 9.93
Extinction Coefficient: 8480
Gravy Index: -.19
Number of Met residues: 2
Percentage of Met residues: 1.54 %
Number of Cys residues: 1
Percentage of Cys residues: 0.77 %
SEQUENCE  amino acids 130 aa
>YP_098753.1  gi|53712761|ref|YP_098753.1| hypothetical protein BF1468 [Bacteroides fragilis YCH46]
MKKRVLLWMAGLVFAVTSLFAQDIPVGVVVAFKKGNSQELNRYLGEKVNLVIQNRSESVD
RQAAEGTLAAFFSSNKVSGFNVNHEGKRDESSFIIGTLTTANGNFRINCFFRRVQNKYLI
NQIRIDKTNE

CDS  cDNA 393 bp
   1 atgaaaaaac gggtactttt atggatggcc ggactcgtat tcgctgtaac ttcgctcttc    60
  61 gcacaggaca taccggtggg cgtggtcgtt gcgtttaaga aaggaaactc ccaagagctg   120
 121 aacaggtatt tgggagagaa ggtgaatctg gtgattcaga atcgctcgga gagtgtagac   180
 181 aggcaggcag ctgaaggaac acttgccgct tttttcagta gcaataaggt cagtggtttt   240
 241 aatgtaaacc atgaaggtaa gcgggatgaa tcgagtttta ttatcggtac cctgaccact   300
 301 gccaacggca atttccggat aaactgcttc ttccgcagag tacagaacaa atatttaata   360
 361 aatcaaataa gaatagataa aaccaatgaa tga   393
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu