LOADING...
   YP_095995.1;SP19248A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_095995.1    SP19248A            JCSG 418779 PDB Deposition 13-MAR-27              PDB id: 4jx2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_095995.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMLegionella pneumophila subsp. pneumophila str. philadelphia 1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4JX2; Identical; 08-MAY-13; HYPOTHETICAL PROTEIN;
DR FFAS; 412202; Fold and function assignment.
DR TVPC; YP_095995.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_095995.1; Ortholog view popup.
DR TPM; YP_095995.1; Target PDB monitor.
DR FSS; YP_095995.1; Target function coverage.
PROPERTY Residues: 455 aa
Molecule Weight: 51060.63 Dalton
Isoelectric Point: 9.03
Extinction Coefficient: 77810
Gravy Index: -.27
Number of Met residues: 17
Percentage of Met residues: 3.74 %
Number of Cys residues: 1
Percentage of Cys residues: 0.22 %
SEQUENCE  amino acids 455 aa
>YP_095995.1  gi|52842196|ref|YP_095995.1| hypothetical protein lpg1979 [Legionella pneumophila subsp. pneumophila
MKTLTTRIFSLIMLLALHFNPIVFAHTNNTNNKGLSASINNGVGSSSSNNTYVTPQAFWN
LYFDFTGDETPGYPKGKINISQTLFQSEMKKNSSLAQQNEGQLILFINSTLYIYNSDRQL
KLKQLMRTAPNSGFTEMTAISHIGPALMYLAKIKENGDASWKSQMENLLKDIQAVKVINA
QTPNNWLEQVNAPAWKPHLTTIHNMIDYACSMAGNYMSDVLNEKLSFDMASLQNDFLNGN
KTYPIPYNNVMIGTFMLTALQSMDQLHSKISQLKIDWPHAKVIIRFVAGSNVSAGVSKGS
NWLVPFVQALSNNKLATDRIYITPYAAVKPSLGAQELTQADYNYYNNTVWGARHNRRIIA
NEVFTNITSIFLPDRPAIPGDYTYSKPPKIEDFLMRLKFSLAEPTEMLSNTVGFWMAGEL
AEKNWNYNKISIPGITTGFPEGISTYPNNNPVIQR

CDS  cDNA 1368 bp
   1 atgaaaacct taacgacccg cattttctcc ctcatcatgt tattggcgtt gcattttaat    60
  61 ccaatcgttt ttgctcatac caataatacc aataataaag gtttatcggc ttccattaat   120
 121 aatggtgtgg gcagtagctc ttctaataac acgtatgtca cacctcaagc tttttggaat   180
 181 ttatattttg atttcaccgg agatgaaact ccaggatatc ccaaaggtaa aatcaatatt   240
 241 tcacaaacct tatttcagtc agaaatgaaa aaaaacagca gcttggcgca gcaaaatgaa   300
 301 ggccaattaa tcctgttcat caactccaca ctttatattt ataatagtga ccgtcagctt   360
 361 aagctaaagc aattgatgcg cactgcgcca aattcaggat tcactgagat gactgcgata   420
 421 tcacacattg gtccagctct gatgtatctc gcaaaaatta aagaaaatgg cgatgcaagc   480
 481 tggaaatcac aaatggaaaa tttacttaag gatatccagg cagtaaaagt aatcaatgca   540
 541 caaacaccca ataattggct ggagcaagtc aatgctccag cctggaagcc tcatctcact   600
 601 acaatccata atatgattga ttatgcctgt tctatggcag gcaattacat gagtgatgta   660
 661 ttgaacgaaa aactatcgtt tgatatggcc tctttacaaa acgactttct taacggcaat   720
 721 aaaacgtatc ctattcctta taataacgtc atgatcggca cttttatgtt aaccgccttg   780
 781 caaagcatgg atcaacttca tagtaaaata agccaattaa aaatagattg gcctcatgcg   840
 841 aaggtaatta ttcgttttgt cgcaggatct aatgtttcag ctggcgtaag caaaggcagc   900
 901 aattggttgg tcccatttgt tcaagcacta tccaataata aattagctac agatagaatt   960
 961 tatatcacgc cttatgccgc agtgaaacca tcgttaggcg cacaagagtt aacacaagca  1020
1021 gattacaact attataataa tacggtatgg ggcgcaagac ataaccgtag aatcatcgcc  1080
1081 aacgaagtct ttactaacat cacgagcatc ttcttaccag atcgacctgc tatacccggt  1140
1141 gattatactt attccaaacc acctaaaatc gaagattttc taatgcgctt aaagttttca  1200
1201 ttggcagaac cgactgaaat gttatccaat actgttgggt tttggatggc tggtgaactt  1260
1261 gccgaaaaaa actggaatta caataaaatc agcatcccgg gtattactac tggtttccca  1320
1321 gaaggcatat ccacctatcc gaacaataat cctgtaatcc agcgatga  1368
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu